Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G39840 110 / 9e-30 ATP-dependent RNA helicase, mitochondrial, putative (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033404 [exp] 195 / 9e-60 AT5G39840 1034 / 0.0 ATP-dependent RNA helicase, mitochondrial, putative (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G081900 [exp] 131 / 7e-37 AT5G39840 1050 / 0.0 ATP-dependent RNA helicase, mitochondrial, putative (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12513 [flax] [poplar] SUV3_C Mitochondrial degradasome RNA helicase subunit C terminal
Representative CDS sequence Show only first row Show all	>Lus10034868 pacid=23142290 polypeptide=Lus10034868 locus=Lus10034868.g ID=Lus10034868.BGIv1.0 annot-version=v1.0 ATGGGTATGCCAAAGGGTTCTGCCAGGAATGACTCTGAGCTCCTGTATCTGGAGACAAAACATGAAGTTCTGTCAATGTACCTATGGTTGTCTCATCAAT TTGACCCTGAAAGTTTTCCACATGTAAAGAAGGCTGAAGCCATGGCGTCAGACATTGCTGATTTATTAGGTCAATCTCTTATTAAAGCAAACTGGAAACC AGAAACAAGGCAGACTGCTGGCAAACCAAAACCTCAAAAGAAAGACGAAGATGGTCACGAGAGGCCTAAATCACTTATCAGATCGTTGGTAGAGTAA
AA sequence Show only first row Show all	>Lus10034868 pacid=23142290 polypeptide=Lus10034868 locus=Lus10034868.g ID=Lus10034868.BGIv1.0 annot-version=v1.0 MGMPKGSARNDSELLYLETKHEVLSMYLWLSHQFDPESFPHVKKAEAMASDIADLLGQSLIKANWKPETRQTAGKPKPQKKDEDGHERPKSLIRSLVE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G39840			ATP-dependent RNA helicase, mi...		Lus10034868 [exp]	0	1
AT1G09620			ATP binding;leucine-tRNA ligas...		Lus10025653 [exp]	5.5	0.8148
AT2G40720			Tetratricopeptide repeat (TPR)...		Lus10027366 [exp]	7.7	0.8174
AT3G06430		AtPPR2, EMB2750	pentatricopeptide repeat 2, em...		Lus10039311 [exp]	10.8	0.7682
AT5G13260			unknown protein		Lus10002574 [exp]	11.6	0.7866
AT1G11290		CRR22	CHLORORESPIRATORY REDUCTION22,...		Lus10016509 [exp]	16.1	0.7736
AT4G18520			Pentatricopeptide repeat (PPR)...		Lus10029482 [exp]	16.2	0.7863
AT3G49142			Tetratricopeptide repeat (TPR)...		Lus10027561 [exp]	20.2	0.7408
AT3G16840			P-loop containing nucleoside t...		Lus10023706 [exp]	23.0	0.7734
AT1G49480	B3	REM19, RTV1	related to vernalization1 1 (....		Lus10009214 [exp]	24.0	0.7538
AT1G70210		ATCYCD1;1, CYCD...	CYCLIN D1;1 (.1)		Lus10029194 [exp]	28.3	0.7706

Compare expression of checked genes

Lus10034868 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.