Lus10034870 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032986 181 / 5e-61 ND /
Lus10004830 184 / 3e-60 AT1G17930 48 / 4e-06 Aminotransferase-like, plant mobile domain family protein (.1)
Lus10009744 178 / 2e-59 ND /
Lus10025363 178 / 7e-59 ND 39 / 0.002
Lus10025367 175 / 1e-58 ND /
Lus10005957 179 / 2e-57 AT1G48120 75 / 1e-14 hydrolases;protein serine/threonine phosphatases (.1)
Lus10006899 172 / 6e-57 ND /
Lus10018964 167 / 1e-54 ND /
Lus10029058 165 / 8e-53 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10034870 pacid=23142165 polypeptide=Lus10034870 locus=Lus10034870.g ID=Lus10034870.BGIv1.0 annot-version=v1.0
ATGCCATTTCAGTCTTTGTTTAGGCGTGCAGAGGATGTGACCGAGGTCGACCCCCGATACATGTACTGGTATAGGCACCACACCCACCCGCACATCCTCA
GACCCATCCCTACTGGTGTAGCGGCGCCGACAGATATGCTAGCTTACAGGGTGTTGGATCATATGCATCCATTCTATACTGGGCAGATGAGACAGGAGTA
CGAGTCTGATGCTGAGTACCTAGAGGCGGTCGAGTATCTGAGATGCAGTGTTGCTGGCATGTACGTGGACTTCCGACACTAG
AA sequence
>Lus10034870 pacid=23142165 polypeptide=Lus10034870 locus=Lus10034870.g ID=Lus10034870.BGIv1.0 annot-version=v1.0
MPFQSLFRRAEDVTEVDPRYMYWYRHHTHPHILRPIPTGVAAPTDMLAYRVLDHMHPFYTGQMRQEYESDAEYLEAVEYLRCSVAGMYVDFRH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10034870 0 1
Lus10011061 4.6 1.0000
Lus10009800 9.5 1.0000
Lus10010609 10.2 1.0000
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10010756 12.3 1.0000
AT4G10020 ATHSD5 hydroxysteroid dehydrogenase 5... Lus10001280 12.4 1.0000
AT3G26590 MATE efflux family protein (.1... Lus10006205 13.8 0.8855
Lus10010778 16.1 1.0000
Lus10011496 18.2 1.0000
AT3G07740 HXA2, HXA02, HA... homolog of yeast ADA2 2A (.1.2... Lus10012337 19.7 1.0000
Lus10011848 20.1 1.0000

Lus10034870 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.