Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034954 [exp] 87 / 6e-22 ND / Lus10032996 [exp] 82 / 2e-19 AT4G02210 49 / 2e-06 unknown protein Lus10023062 [exp] 81 / 2e-19 AT4G02210 67 / 4e-12 unknown protein Lus10005382 [exp] 75 / 8e-17 AT1G79400 342 / 8e-108 cation/H+ exchanger 2, cation/H+ exchanger 2, cation/H+ exchanger 2 (.1) Lus10036046 [exp] 71 / 2e-15 AT1G33811 188 / 1e-55 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10008445 [exp] 49 / 1e-08 ND / Lus10032874 [exp] 46 / 1e-06 AT5G27260 53 / 1e-07 unknown protein Lus10033100 [exp] 46 / 1e-06 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034871 pacid=23142164 polypeptide=Lus10034871 locus=Lus10034871.g ID=Lus10034871.BGIv1.0 annot-version=v1.0 ATGGCACACATATATAATGCATGGTCTAAGCCCGAAACAGAAACTTTCTTCGAGATGTTGCTACAACTTCATTCAACTGGGCTGATTCAGAAATTAAATC TGGCTTACCGGTTTGCATGTAGCTTGCACAAGACAAGGCTTGACCACTGGGATGAGCTCTATAAGATCTTCGAATGTAGTCGTGCAGACGGGATGGAAGG CATGACTACAACTGACGCGGCAAGTGTGCTCGAGGCTGAAATTCGGGCGTCCGGAACCACACCAAACATATCGGATGAGAACTACGGAGCTGAGACAACA CCAATGATGAAGGACTTCTTCAACGCTGGTTTTGACATTTGA
AA sequence Show only first row Show all	>Lus10034871 pacid=23142164 polypeptide=Lus10034871 locus=Lus10034871.g ID=Lus10034871.BGIv1.0 annot-version=v1.0 MAHIYNAWSKPETETFFEMLLQLHSTGLIQKLNLAYRFACSLHKTRLDHWDELYKIFECSRADGMEGMTTTDAASVLEAEIRASGTTPNISDENYGAETT PMMKDFFNAGFDI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10034871 [exp]	0	1
AT5G39670			Calcium-binding EF-hand family...		Lus10026301 [exp]	2.8	0.8749
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Lus10009833 [exp]	6.0	0.8784
AT5G48290			Heavy metal transport/detoxifi...		Lus10016062 [exp]	6.9	0.8729
AT5G19450		CPK8, CDPK19	calcium-dependent protein kina...		Lus10030134 [exp]	17.4	0.8554
AT4G39480		CYP96A9	"cytochrome P450, family 96, s...		Lus10018157 [exp]	17.6	0.7971
AT5G22380	NAC	ANAC090	NAC domain containing protein ...		Lus10004846 [exp]	22.6	0.8348
AT4G10790			UBX domain-containing protein ...		Lus10039951 [exp]	22.9	0.8544
AT5G01750			Protein of unknown function (D...		Lus10009093 [exp]	23.4	0.8354
AT1G35470			SPla/RYanodine receptor (SPRY)...		Lus10020191 [exp]	26.3	0.8542
AT3G56710		SIB1	sigma factor binding protein 1...		Lus10026165 [exp]	26.7	0.8459

Compare expression of checked genes

Lus10034871 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.