Lus10034884 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036784 96 / 2e-25 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10034884 pacid=23142203 polypeptide=Lus10034884 locus=Lus10034884.g ID=Lus10034884.BGIv1.0 annot-version=v1.0
ATGTGGTACTTAATTCCTAGGAAGAGCTTCACGGATGGTAGCAAAACCGTGGTGGAGATATTCAGCAATATTGAACTTGTTGGGGGCTTACTACAAGTGG
CAGAACTTAGACGTATCCAGTTGTTCTATAATTGTGTGAAGAAGCATGTTAGTGATAACCTAACTACAGGGGGAATTCAAGGTAGAGCACAAGACAGTGA
TTTAGCTTACGGAGAGGAAGGTGATCAGTCTTTAGGAATAGGAAGACTAATTCAAATTCTACCAGAAGAACTAGGCATGGCAAATGGGACAGGGTGGTCA
ATTATAACAGATCAACATAACGATGTTCGTGCTAAACCTGATGAATAA
AA sequence
>Lus10034884 pacid=23142203 polypeptide=Lus10034884 locus=Lus10034884.g ID=Lus10034884.BGIv1.0 annot-version=v1.0
MWYLIPRKSFTDGSKTVVEIFSNIELVGGLLQVAELRRIQLFYNCVKKHVSDNLTTGGIQGRAQDSDLAYGEEGDQSLGIGRLIQILPEELGMANGTGWS
IITDQHNDVRAKPDE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10034884 0 1
Lus10039994 1.7 0.8409
AT3G57170 N-acetylglucosaminyl transfera... Lus10003248 2.0 0.8512
AT1G15520 ATABCG40, ABCG4... Arabidopsis thaliana ATP-bindi... Lus10022663 4.0 0.8393
AT1G66140 C2H2ZnF ZFP4 zinc finger protein 4 (.1) Lus10026597 4.5 0.8423
AT3G23610 DSPTP1 dual specificity protein phosp... Lus10021940 4.5 0.8388
Lus10010597 4.9 0.8181
Lus10003883 5.5 0.8250
AT4G12010 Disease resistance protein (TI... Lus10015648 7.7 0.7978
AT1G32400 TOM2A tobamovirus multiplication 2A ... Lus10040108 7.9 0.8197
Lus10039327 8.5 0.7975

Lus10034884 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.