Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034887 pacid=23142273 polypeptide=Lus10034887 locus=Lus10034887.g ID=Lus10034887.BGIv1.0 annot-version=v1.0 ATGGCGATGGATGATGAAGAAGAAGATTTAACTCTCTTTACTTTGCGGTTTGAGGGAGGAACTGGAAGAGCATTTCAACTGTTATGTGGAGTTTGGATTA AGTGGACAATTAGAAACGGGGTGGTTCACGAGCTTGCTTATCGTTCCCACAGTTTTGCGTCCATCCTTTTTAGGGGAGATGCATTGCTTCTTGATGATTT AGAGTTTGTACCGAAAGATATCTGGTTCTAG
AA sequence Show only first row Show all	>Lus10034887 pacid=23142273 polypeptide=Lus10034887 locus=Lus10034887.g ID=Lus10034887.BGIv1.0 annot-version=v1.0 MAMDDEEEDLTLFTLRFEGGTGRAFQLLCGVWIKWTIRNGVVHELAYRSHSFASILFRGDALLLDDLEFVPKDIWF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10034887 [exp]	0	1
AT2G45490		ATAUR3	ataurora3 (.1)		Lus10020580 [exp]	5.7	0.8020
AT2G26710		CYP72B1, CYP734...	PHYB ACTIVATION TAGGED SUPPRES...		Lus10017771 [exp]	5.7	0.7678
AT5G66240			Transducin/WD40 repeat-like su...		Lus10017157 [exp]	7.1	0.7974
AT2G47640			Small nuclear ribonucleoprotei...		Lus10013840 [exp]	14.5	0.7633
AT4G09550		ATGIP1	ARABIDOPSIS ATGCP3 INTERACTING...		Lus10018288 [exp]	18.3	0.6884
AT5G41050			Pollen Ole e 1 allergen and ex...		Lus10041541 [exp]	19.6	0.7598
AT5G43460			HR-like lesion-inducing protei...		Lus10041152 [exp]	21.5	0.7601
AT3G22142			Bifunctional inhibitor/lipid-t...		Lus10003801 [exp]	22.7	0.7512
AT5G58490			NAD(P)-binding Rossmann-fold s...		Lus10026385 [exp]	23.5	0.7223
AT2G27970		CKS2	CDK-subunit 2 (.1)		Lus10021405 [exp]	29.2	0.7624

Compare expression of checked genes

Lus10034887 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.