Lus10034888 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G20810 209 / 4e-70 SAUR-like auxin-responsive protein family (.1.2)
AT3G43120 201 / 6e-67 SAUR-like auxin-responsive protein family (.1)
AT2G24400 99 / 1e-26 SAUR-like auxin-responsive protein family (.1)
AT4G31320 94 / 2e-24 SAUR-like auxin-responsive protein family (.1)
AT2G18010 86 / 6e-22 SAUR-like auxin-responsive protein family (.1)
AT2G21220 81 / 4e-20 SAUR-like auxin-responsive protein family (.1)
AT4G34800 79 / 2e-19 SAUR-like auxin-responsive protein family (.1)
AT1G19830 79 / 2e-19 SAUR-like auxin-responsive protein family (.1)
AT1G75580 77 / 1e-18 SAUR-like auxin-responsive protein family (.1)
AT4G38840 77 / 1e-18 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026977 87 / 1e-21 AT2G24400 184 / 1e-59 SAUR-like auxin-responsive protein family (.1)
Lus10012189 84 / 2e-21 AT4G34760 169 / 3e-56 SAUR-like auxin-responsive protein family (.1)
Lus10007553 84 / 4e-21 AT4G34760 168 / 9e-56 SAUR-like auxin-responsive protein family (.1)
Lus10034507 80 / 3e-19 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1)
Lus10029198 79 / 3e-19 AT4G38840 119 / 2e-36 SAUR-like auxin-responsive protein family (.1)
Lus10025911 78 / 3e-19 AT4G38840 118 / 4e-36 SAUR-like auxin-responsive protein family (.1)
Lus10008999 78 / 6e-19 AT4G38840 117 / 7e-36 SAUR-like auxin-responsive protein family (.1)
Lus10008995 78 / 6e-19 AT4G38840 119 / 2e-36 SAUR-like auxin-responsive protein family (.1)
Lus10009624 77 / 7e-19 AT4G38840 119 / 9e-37 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G137200 234 / 2e-79 AT5G20810 201 / 1e-66 SAUR-like auxin-responsive protein family (.1.2)
Potri.018G063400 219 / 4e-74 AT5G20810 219 / 3e-74 SAUR-like auxin-responsive protein family (.1.2)
Potri.006G278100 93 / 3e-24 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1)
Potri.008G003900 92 / 4e-24 AT2G24400 110 / 1e-31 SAUR-like auxin-responsive protein family (.1)
Potri.010G253800 90 / 6e-23 AT2G24400 142 / 4e-43 SAUR-like auxin-responsive protein family (.1)
Potri.009G126000 83 / 4e-21 AT4G34760 179 / 4e-60 SAUR-like auxin-responsive protein family (.1)
Potri.004G164400 83 / 6e-21 AT4G34760 182 / 4e-61 SAUR-like auxin-responsive protein family (.1)
Potri.008G037900 81 / 6e-20 AT2G37030 103 / 2e-29 SAUR-like auxin-responsive protein family (.1)
Potri.006G211000 80 / 1e-19 AT2G36210 130 / 3e-40 SAUR-like auxin-responsive protein family (.1)
Potri.002G024500 80 / 2e-19 AT1G75590 194 / 1e-64 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10034888 pacid=23142190 polypeptide=Lus10034888 locus=Lus10034888.g ID=Lus10034888.BGIv1.0 annot-version=v1.0
ATGGATGATCAAGTAAGCAATAATAATAAGGCAACAGGAATTCGACAGATTATTAGGCTAAGAGAACTTCTTCAGAAGTGGCAAACAGTGAGAACCGGGC
CAAGGCCGAGCAACCCTCCTAGTAGTAACCAAGGTGGTGGTATCCCACCAGCAATTAACAAGAGGGTGGCATGTATTAGAAATATTTGTGATTCAGATGA
GGAAGGGTGTCAAAGTCCAGAACCCCCAGTTGATGTCCCCAAAGGGTATCTCGCGGTTTATGTTGGGCCAGAGCTTCGGAGGTTTATCATCCCCACCAGT
TACCTTAGCCACTCTTTGTTCAAAGTCCTGCTAGAAAAGACTGAAGAGGAGTTTGGGTTCGATCATAGCGGCGCACTCACTATCCCCTGCGAGATTGAGA
CCTTCAAGTTTCTACTCAATTGTATGGAGCATCATCCTAAAGATGGCAATAACGACGGCCAGAGTAAGATGTCTTTCTTCTTCCCGACATATCTTGTGAT
TGATGCTTCCATGATATGCATTTCTTGA
AA sequence
>Lus10034888 pacid=23142190 polypeptide=Lus10034888 locus=Lus10034888.g ID=Lus10034888.BGIv1.0 annot-version=v1.0
MDDQVSNNNKATGIRQIIRLRELLQKWQTVRTGPRPSNPPSSNQGGGIPPAINKRVACIRNICDSDEEGCQSPEPPVDVPKGYLAVYVGPELRRFIIPTS
YLSHSLFKVLLEKTEEEFGFDHSGALTIPCEIETFKFLLNCMEHHPKDGNNDGQSKMSFFFPTYLVIDASMICIS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G20810 SAUR-like auxin-responsive pro... Lus10034888 0 1
AT3G03480 CHAT acetyl CoA:(Z)-3-hexen-1-ol ac... Lus10020334 4.0 0.7463
AT1G66350 GRAS RGL1 RGA-like 1 (.1) Lus10041128 4.2 0.7666
AT1G26730 EXS (ERD1/XPR1/SYG1) family pr... Lus10004284 6.3 0.7663
AT1G22400 ATUGT85A1, UGT8... ARABIDOPSIS THALIANA UDP-GLUCO... Lus10013920 7.5 0.7654
AT4G12490 Bifunctional inhibitor/lipid-t... Lus10024619 8.5 0.6561
AT2G16730 BGAL13 beta-galactosidase 13, glycosy... Lus10014126 8.7 0.7654
AT3G13790 ATCWINV1, ATBFR... ARABIDOPSIS THALIANA CELL WALL... Lus10022696 9.2 0.6580
AT5G45670 GDSL-like Lipase/Acylhydrolase... Lus10015241 9.7 0.7654
AT5G20260 Exostosin family protein (.1) Lus10039980 10.7 0.7654
AT1G22380 ATUGT85A3 UDP-glucosyl transferase 85A3 ... Lus10013919 12.1 0.7509

Lus10034888 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.