Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G67910 50 / 2e-09 unknown protein AT3G13227 45 / 2e-07 serine-rich protein-related (.1) AT1G24577 43 / 6e-07 unknown protein AT3G56500 43 / 1e-06 serine-rich protein-related (.1) AT5G25280 44 / 2e-06 serine-rich protein-related (.1.2) AT5G20370 43 / 4e-06 serine-rich protein-related (.1) AT5G55980 42 / 6e-06 serine-rich protein-related (.1) AT5G11090 42 / 2e-05 serine-rich protein-related (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023632 [exp] 132 / 9e-42 AT1G67910 48 / 1e-08 unknown protein Lus10011094 [exp] 52 / 4e-10 AT5G55980 44 / 1e-06 serine-rich protein-related (.1) Lus10043215 [exp] 51 / 9e-10 AT5G55980 44 / 8e-07 serine-rich protein-related (.1) Lus10006660 [exp] 47 / 2e-07 AT5G25280 144 / 4e-43 serine-rich protein-related (.1.2) Lus10039998 [exp] 46 / 4e-07 AT5G25280 157 / 3e-48 serine-rich protein-related (.1.2) Lus10023227 [exp] 44 / 7e-07 AT5G55980 69 / 3e-16 serine-rich protein-related (.1) Lus10008880 [exp] 44 / 7e-07 AT5G55980 63 / 1e-13 serine-rich protein-related (.1) Lus10008808 [exp] 45 / 1e-06 AT5G25280 153 / 2e-46 serine-rich protein-related (.1.2) Lus10038100 [exp] 45 / 1e-06 AT5G25280 145 / 4e-43 serine-rich protein-related (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G079200 [exp] 66 / 1e-15 AT1G67910 45 / 9e-08 unknown protein Potri.001G371400 [exp] 46 / 3e-07 AT5G55980 50 / 2e-08 serine-rich protein-related (.1) Potri.010G046700 [exp] 44 / 6e-07 AT1G67910 82 / 4e-22 unknown protein Potri.006G060700 [exp] 43 / 2e-06 AT5G11090 66 / 4e-14 serine-rich protein-related (.1) Potri.002G250700 [exp] 43 / 2e-06 AT3G56500 43 / 5e-06 serine-rich protein-related (.1) Potri.006G159300 [exp] 42 / 2e-06 AT1G24577 43 / 5e-07 unknown protein Potri.008G186200 [exp] 42 / 2e-06 AT1G67910 85 / 4e-23 unknown protein Potri.018G078900 [exp] 42 / 4e-06 AT3G13227 42 / 3e-06 serine-rich protein-related (.1) Potri.018G120300 [exp] 42 / 5e-06 AT5G11090 67 / 1e-14 serine-rich protein-related (.1) Potri.006G060800 [exp] 41 / 2e-05 AT5G25280 130 / 2e-37 serine-rich protein-related (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034901 pacid=23181373 polypeptide=Lus10034901 locus=Lus10034901.g ID=Lus10034901.BGIv1.0 annot-version=v1.0 ATGGCTTCTCACGGAAGCCTAACGGTTTCAATTATCTCACCGAAAGGCGGCACCGATAGGGAAGGCGCCGGAAGGCCTACTTCCGGTGGGCAGTGCCTGT GCTCGCCGACGACGCACCCGGGATCCTTTAGGTGCAGGCTCCATCGCAGTACTTCTTCTTCATCGGCGGCTTGGAATAAGATGAAACGATCATCTTCCAT CCCAGCTTATGAAAGTTCTGCTGCTCATAACTCTTCTACTTCGTCTGGGGATTGTATTTCTTCCAATTCTGTTGAATGA
AA sequence Show only first row Show all	>Lus10034901 pacid=23181373 polypeptide=Lus10034901 locus=Lus10034901.g ID=Lus10034901.BGIv1.0 annot-version=v1.0 MASHGSLTVSIISPKGGTDREGAGRPTSGGQCLCSPTTHPGSFRCRLHRSTSSSSAAWNKMKRSSSIPAYESSAAHNSSTSSGDCISSNSVE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G67910			unknown protein		Lus10034901 [exp]	0	1
AT3G01990		ACR6	ACT domain repeat 6 (.1)		Lus10012550 [exp]	3.7	0.9000
AT4G27130			Translation initiation factor ...		Lus10015124 [exp]	6.2	0.9019
AT5G06130			chaperone protein dnaJ-related...		Lus10014223 [exp]	6.9	0.8639
AT1G13740		AFP2	ABI five binding protein 2 (.1...		Lus10037084 [exp]	9.6	0.8739
AT5G54940			Translation initiation factor ...		Lus10021532 [exp]	10.2	0.8915
AT1G13570			F-box/RNI-like superfamily pro...		Lus10016297 [exp]	11.5	0.8643
AT1G71180			6-phosphogluconate dehydrogena...		Lus10015455 [exp]	21.4	0.8422
AT3G56310			Melibiase family protein (.1.2...		Lus10029046 [exp]	22.0	0.8655
AT3G07870			F-box and associated interacti...		Lus10006403 [exp]	23.0	0.8379
AT1G71340		AtGDPD4	glycerophosphodiester phosphod...		Lus10013777 [exp]	24.3	0.8242

Compare expression of checked genes

Lus10034901 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.