Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G49340 59 / 3e-11 ATPI4K ALPHA, ATPI4KALPHA Phosphatidylinositol 3- and 4-kinase family protein (.1.2) AT1G51040 58 / 5e-11 Protein kinase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011922 [exp] 76 / 9e-19 ND / Lus10011315 [exp] 77 / 6e-18 AT1G49340 307 / 9e-96 Phosphatidylinositol 3- and 4-kinase family protein (.1.2) Lus10006124 [exp] 74 / 2e-16 AT3G22520 340 / 4e-106 unknown protein Lus10039532 [exp] 67 / 5e-15 ND / Lus10002796 [exp] 63 / 6e-14 ND / Lus10040481 [exp] 65 / 4e-13 AT1G49340 1556 / 0.0 Phosphatidylinositol 3- and 4-kinase family protein (.1.2) Lus10011285 [exp] 65 / 4e-13 AT1G49340 3010 / 0.0 Phosphatidylinositol 3- and 4-kinase family protein (.1.2) Lus10038591 [exp] 61 / 6e-12 ND / Lus10018790 [exp] 50 / 3e-08 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G113700 [exp] 61 / 5e-12 AT1G49340 3062 / 0.0 Phosphatidylinositol 3- and 4-kinase family protein (.1.2) Potri.004G152400 [exp] 59 / 5e-11 AT1G49340 2964 / 0.0 Phosphatidylinositol 3- and 4-kinase family protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034915 pacid=23181375 polypeptide=Lus10034915 locus=Lus10034915.g ID=Lus10034915.BGIv1.0 annot-version=v1.0 ATGGATGATGCCTTTCAAGAACTCTTGCCTGTTGTTCGTGAGCATATCGTTGATGGTTTCAATGACAAGGCCCGTGATGTTGGAGATGATTGCACACAAG ATGTGCTTGCCCTTGAAGTGATAACGCTTCTTAGAGACATTTTTGGTGCTGTCGGCCTTAATCTCTATTTGTTTCTATTGAAGCGATATACGATGTTTGA GGATAAGCAGGAGTGGAAACGGACGGATTTGGAGCAGCAGGAGAGGAACACGGCGTGTTCCAGGTGTGAATCAAAGCGAAAAACTTACAGGGGAGGAACA CGGCGTGTTCCACATGGAACACGACATGTTACATCCCAGACAGATTTTTAA
AA sequence Show only first row Show all	>Lus10034915 pacid=23181375 polypeptide=Lus10034915 locus=Lus10034915.g ID=Lus10034915.BGIv1.0 annot-version=v1.0 MDDAFQELLPVVREHIVDGFNDKARDVGDDCTQDVLALEVITLLRDIFGAVGLNLYLFLLKRYTMFEDKQEWKRTDLEQQERNTACSRCESKRKTYRGGT RRVPHGTRHVTSQTDF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G49340		ATPI4K ALPHA, A...	Phosphatidylinositol 3- and 4-...		Lus10034915 [exp]	0	1

Compare expression of checked genes

Lus10034915 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.