Lus10034928 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G42030 87 / 2e-21 ABIL4 ABL interactor-like protein 4 (.1)
AT2G46225 73 / 5e-16 ABIL1, ABI1L1 ABI-1-like 1 (.1.2.3)
AT3G49290 69 / 1e-14 ABIL2 ABL interactor-like protein 2 (.1.2)
AT5G24310 65 / 3e-13 ABIL3 ABL interactor-like protein 3 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023654 218 / 5e-72 AT5G42030 91 / 3e-21 ABL interactor-like protein 4 (.1)
Lus10043223 151 / 4e-43 AT2G32230 433 / 2e-142 proteinaceous RNase P 1 (.1)
Lus10011102 147 / 1e-41 AT4G29010 1043 / 0.0 ABNORMAL INFLORESCENCE MERISTEM, Enoyl-CoA hydratase/isomerase family (.1)
Lus10002151 75 / 1e-16 AT2G46225 370 / 2e-129 ABI-1-like 1 (.1.2.3)
Lus10008737 75 / 2e-16 AT2G46225 377 / 5e-132 ABI-1-like 1 (.1.2.3)
Lus10005919 70 / 9e-15 AT5G24310 400 / 2e-140 ABL interactor-like protein 3 (.1.2)
Lus10022393 60 / 3e-11 AT5G24310 360 / 2e-125 ABL interactor-like protein 3 (.1.2)
Lus10032421 56 / 1e-09 AT3G49290 171 / 2e-51 ABL interactor-like protein 2 (.1.2)
Lus10023052 47 / 5e-07 AT5G24310 101 / 7e-27 ABL interactor-like protein 3 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G082600 130 / 3e-38 AT2G46225 94 / 1e-22 ABI-1-like 1 (.1.2.3)
Potri.002G165900 77 / 2e-17 AT2G46225 397 / 5e-140 ABI-1-like 1 (.1.2.3)
Potri.014G092300 77 / 2e-17 AT2G46225 396 / 1e-139 ABI-1-like 1 (.1.2.3)
Potri.003G142800 76 / 6e-17 AT3G49290 292 / 3e-98 ABL interactor-like protein 2 (.1.2)
Potri.012G016900 67 / 1e-13 AT3G49290 353 / 5e-122 ABL interactor-like protein 2 (.1.2)
Potri.001G088100 60 / 4e-11 AT3G49290 265 / 9e-88 ABL interactor-like protein 2 (.1.2)
PFAM info
Representative CDS sequence
>Lus10034928 pacid=23181399 polypeptide=Lus10034928 locus=Lus10034928.g ID=Lus10034928.BGIv1.0 annot-version=v1.0
ATGTTTGACGCAGAGCTTGGTTCTCCAATTTCAATGGTTCCGGGTCTGGAGCTTAAGGAGTTGAAGTCTCAGCTCCATAATGCAGCAGCTTACTGCGAGA
AGAGTTTTCTCAAGTCCAACGACAAGAAAAAGATACTGGAGAGCACAAAAGAGTACGTCTGCAGTGCCGTTGTAACAGTTGTGGATCATTTGGGCAGTGT
TTCAGCCAATCTGAACATCACCATTTCTGACAATGCTACTGGCTTCTCTGAAGCTGAACTCAGGATACATTCCTTGAAGCAAAGATTTCTTGCGTATGAA
CTGTACGCACAGAAGATTGCACTGACTAGGACAAGATGGAGCCGCAACTTCCCAAAATCACAACCCCGCTATCTCTGGACACGTAAGGGTTCTTTTTGCC
GTCCAATTGATTCGAGTAACGTTGAGGTTCGACCAATAGAATAA
AA sequence
>Lus10034928 pacid=23181399 polypeptide=Lus10034928 locus=Lus10034928.g ID=Lus10034928.BGIv1.0 annot-version=v1.0
MFDAELGSPISMVPGLELKELKSQLHNAAAYCEKSFLKSNDKKKILESTKEYVCSAVVTVVDHLGSVSANLNITISDNATGFSEAELRIHSLKQRFLAYE
LYAQKIALTRTRWSRNFPKSQPRYLWTRKGSFCRPIDSSNVEVRPIE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G42030 ABIL4 ABL interactor-like protein 4 ... Lus10034928 0 1
AT1G74670 GASA6 GA-stimulated Arabidopsis 6, G... Lus10008612 2.0 0.8464
AT2G32580 Protein of unknown function (D... Lus10029975 2.4 0.8106
AT5G50335 unknown protein Lus10008207 6.2 0.8170
AT1G62400 HT1 high leaf temperature 1, Prote... Lus10002374 11.0 0.7737
AT4G35690 Arabidopsis protein of unknown... Lus10041834 13.3 0.7192
AT2G26730 Leucine-rich repeat protein ki... Lus10001900 16.1 0.7764
AT1G67400 ELMO/CED-12 family protein (.1... Lus10037017 17.1 0.7709
AT4G25050 ACP4 acyl carrier protein 4 (.1.2) Lus10037910 17.9 0.7183
AT5G58300 Leucine-rich repeat protein ki... Lus10003891 18.0 0.6872
AT4G03110 AtRBP-DR1 RNA-binding protein-defense re... Lus10040910 23.7 0.7348

Lus10034928 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.