Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G60680 42 / 3e-05 Plant protein of unknown function (DUF641) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009284 [exp] 77 / 2e-17 AT3G60680 541 / 0.0 Plant protein of unknown function (DUF641) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G066600 [exp] 51 / 9e-09 AT3G60680 522 / 0.0 Plant protein of unknown function (DUF641) (.1) Potri.002G145000 [exp] 50 / 2e-08 AT3G60680 494 / 4e-172 Plant protein of unknown function (DUF641) (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034935 pacid=23181354 polypeptide=Lus10034935 locus=Lus10034935.g ID=Lus10034935.BGIv1.0 annot-version=v1.0 ATGGACGCAGGCCTGGACATCCACCACTCTTCCAACCAGAAGGCCCCGCAAATCTCTAATATATTCCAGAAATTCACCCTACCTTTCAAAGCCAAGACAT TCGACTTCTTCGCCGAAGGAGAAGAAGACGCTGCCGCTGCTGATGATGACGGTTTCACTCTCTTCAACACCATCGAGGACTTCATTCCCGATCAGAAGGT TATCATGCTCAAGCCAGACCACCCAGCTGCAGCAGAGGAGACTAAAGAGTCTGCAACAAAGCCAAATTCAATTCTCCCGACCGGATCCGACGACCTGTGG ACACCCGCTTGA
AA sequence Show only first row Show all	>Lus10034935 pacid=23181354 polypeptide=Lus10034935 locus=Lus10034935.g ID=Lus10034935.BGIv1.0 annot-version=v1.0 MDAGLDIHHSSNQKAPQISNIFQKFTLPFKAKTFDFFAEGEEDAAAADDDGFTLFNTIEDFIPDQKVIMLKPDHPAAAEETKESATKPNSILPTGSDDLW TPA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G60680			Plant protein of unknown funct...		Lus10034935 [exp]	0	1
AT1G16930			F-box/RNI-like/FBD-like domain...		Lus10023036 [exp]	2.6	0.8332
AT1G06340			Plant Tudor-like protein (.1)		Lus10039027 [exp]	3.7	0.8332
AT5G36220		CYP91A1, CYP81D...	CYTOCHROME P450 91A1, cytochro...		Lus10018718 [exp]	4.6	0.8332
AT4G05200		CRK25	cysteine-rich RLK (RECEPTOR-li...		Lus10026169 [exp]	5.3	0.8332
AT2G44220			Protein of Unknown Function (D...		Lus10006862 [exp]	5.9	0.8332
AT4G26466		LRE	lorelei (.1)		Lus10011066 [exp]	6.9	0.7597
AT5G28823			unknown protein		Lus10040056 [exp]	7.0	0.7130
AT2G32645			Domain of unknown function (DU...		Lus10020591 [exp]	7.5	0.7024
AT5G25180		CYP71B14	"cytochrome P450, family 71, s...		Lus10024331 [exp]	9.0	0.6810
AT4G25950		VATG3	vacuolar ATP synthase G3 (.1)		Lus10009452 [exp]	11.0	0.6727

Compare expression of checked genes

Lus10034935 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.