Lus10034936 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G16180 172 / 1e-50 Major facilitator superfamily protein (.1)
AT1G52190 170 / 2e-49 Major facilitator superfamily protein (.1)
AT1G68570 143 / 1e-39 Major facilitator superfamily protein (.1)
AT1G72140 139 / 2e-38 Major facilitator superfamily protein (.1)
AT1G22540 138 / 5e-38 Major facilitator superfamily protein (.1)
AT3G54140 130 / 5e-35 ATPTR1 ARABIDOPSIS THALIANA PEPTIDE TRANSPORTER 1, peptide transporter 1 (.1)
AT5G62680 129 / 1e-34 Major facilitator superfamily protein (.1)
AT3G54450 128 / 2e-34 Major facilitator superfamily protein (.1)
AT1G72120 128 / 3e-34 Major facilitator superfamily protein (.1)
AT1G22550 127 / 3e-34 Major facilitator superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023663 359 / 2e-122 AT3G16180 559 / 0.0 Major facilitator superfamily protein (.1)
Lus10035860 176 / 1e-51 AT1G52190 787 / 0.0 Major facilitator superfamily protein (.1)
Lus10025802 171 / 9e-50 AT1G52190 764 / 0.0 Major facilitator superfamily protein (.1)
Lus10008539 150 / 1e-42 AT1G52190 371 / 8e-122 Major facilitator superfamily protein (.1)
Lus10017817 150 / 3e-42 AT1G68570 637 / 0.0 Major facilitator superfamily protein (.1)
Lus10018838 150 / 3e-42 AT1G68570 571 / 0.0 Major facilitator superfamily protein (.1)
Lus10030947 142 / 3e-39 AT2G02040 884 / 0.0 NITRATE TRANSPORTER 1, ARABIDOPSIS THALIANA PEPTIDE TRANSPORTER 2, peptide transporter 2 (.1)
Lus10041466 141 / 1e-38 AT1G68570 850 / 0.0 Major facilitator superfamily protein (.1)
Lus10040099 140 / 2e-38 AT2G02040 883 / 0.0 NITRATE TRANSPORTER 1, ARABIDOPSIS THALIANA PEPTIDE TRANSPORTER 2, peptide transporter 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G087500 253 / 4e-81 AT1G52190 542 / 0.0 Major facilitator superfamily protein (.1)
Potri.001G185700 190 / 5e-57 AT1G52190 785 / 0.0 Major facilitator superfamily protein (.1)
Potri.018G041800 165 / 9e-48 AT1G52190 551 / 0.0 Major facilitator superfamily protein (.1)
Potri.018G041500 159 / 9e-46 AT1G52190 561 / 0.0 Major facilitator superfamily protein (.1)
Potri.018G040500 159 / 1e-45 AT1G52190 561 / 0.0 Major facilitator superfamily protein (.1)
Potri.018G041400 159 / 1e-45 AT1G52190 562 / 0.0 Major facilitator superfamily protein (.1)
Potri.018G040400 155 / 2e-44 AT3G16180 559 / 0.0 Major facilitator superfamily protein (.1)
Potri.018G041600 155 / 2e-44 AT1G52190 590 / 0.0 Major facilitator superfamily protein (.1)
Potri.006G240000 155 / 4e-44 AT1G52190 628 / 0.0 Major facilitator superfamily protein (.1)
Potri.018G041700 153 / 2e-43 AT1G52190 562 / 0.0 Major facilitator superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0015 MFS PF00854 PTR2 POT family
Representative CDS sequence
>Lus10034936 pacid=23181339 polypeptide=Lus10034936 locus=Lus10034936.g ID=Lus10034936.BGIv1.0 annot-version=v1.0
ATGGTGTATTCGGCATCATCACCGTCACTGTGTTGGGTGGCATTGTACGACCGCATTTTGGTTCCCATCCTCGCCAAATTCTTCAATCTCCCCGCTGGGA
TCTCCAATAAGCATCGGATGGGTATCGTCTTTGCGATCTCTTGCATTGCAACTGCGGTCGCAGGCTTGGTAGAGCACCAACGACGAGCGGTGGCATTTAG
GGAAGGCGTCGCGGATGACCACAATGCTGTGGCGGGGATGTCGGCCAACTGGCTGATTATTCAGTACTGTTTGATCGGACTTGCTTTCAGCATGATAGGT
CAGATCGAATTCTATTACTCGCAGTTCCCAAGGAACATGAGGAGTATTGCCATGGCGTTGGTGTCCCTAGGGCTTGGAATGGGGAATTTAGCGGGAAGTT
TGATTGTAACGGTGGTTAATAACGTCACTAGGCGAGGCGGGAAAGTTAGCTGGGTGGGTAATAATTTGAATAGGGGACACTATGACTATTACTATTGGCT
GCTGTCAGCTTTGAGTGTCGGGAATTTCTTTTACTATTTGGTTCTTAGCTGGGCTTATGGGAATGACGACAGAAAGATTTGGGATGAGGCCGAAGCAGAG
AACGACGACGCAGAAGAAAGGGAGATGAAGAGTATGGAACGAGACTTGTGA
AA sequence
>Lus10034936 pacid=23181339 polypeptide=Lus10034936 locus=Lus10034936.g ID=Lus10034936.BGIv1.0 annot-version=v1.0
MVYSASSPSLCWVALYDRILVPILAKFFNLPAGISNKHRMGIVFAISCIATAVAGLVEHQRRAVAFREGVADDHNAVAGMSANWLIIQYCLIGLAFSMIG
QIEFYYSQFPRNMRSIAMALVSLGLGMGNLAGSLIVTVVNNVTRRGGKVSWVGNNLNRGHYDYYYWLLSALSVGNFFYYLVLSWAYGNDDRKIWDEAEAE
NDDAEEREMKSMERDL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G16180 Major facilitator superfamily ... Lus10034936 0 1
Lus10010778 4.7 1.0000
AT4G01830 ABCB5, PGP5 ATP-binding cassette B5, P-gly... Lus10004529 5.4 1.0000
Lus10011496 7.3 1.0000
AT1G67623 F-box family protein (.1) Lus10022147 10.5 1.0000
Lus10011759 10.8 1.0000
AT1G26420 FAD-binding Berberine family p... Lus10023368 12.2 1.0000
AT1G48120 hydrolases;protein serine/thre... Lus10007708 13.9 1.0000
AT2G20420 ATP citrate lyase (ACL) family... Lus10024923 15.2 1.0000
AT1G26480 GF14IOTA, GRF12 general regulatory factor 12 (... Lus10026660 15.6 1.0000
Lus10024550 15.7 1.0000

Lus10034936 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.