Lus10034942 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012430 0 / 1 ND /
Lus10033176 0 / 1 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10034942 pacid=23181357 polypeptide=Lus10034942 locus=Lus10034942.g ID=Lus10034942.BGIv1.0 annot-version=v1.0
ATGACTTGCTCGCCAACACATCACGTCGACATCTCTCATGGTCATGTGCTCACGCCCACACCATCACTACTCACCACCGTCATTAATGGCTGTCGGAGGC
CATCACGACATGTGGCAATCACTCATGGTTATGTCAATACCTCAACCCATCAAGCCATCAACTCTTCTCACCACCCTTACGTCAATGTCTCACCTACACA
AACAAGGTCACAATCATTAGATGGTGTTAACTCAACACCAAATAATGGGAATGCAAATGGTCCTCCCGTCGGTGGCCAGACTGGCCAACCACGACAAGAG
AATCTTTCGTCGGTGAATAATGAATCATTCCCTCACCACACGAATTGGGTGATGTCCTCATCACTCATGAGGAGGGCTCACGTGAATTGGGAACAGGAGA
ACTTCCATCACGTGGTGAAAATCATGTCCCCACATTCAATACTCTAG
AA sequence
>Lus10034942 pacid=23181357 polypeptide=Lus10034942 locus=Lus10034942.g ID=Lus10034942.BGIv1.0 annot-version=v1.0
MTCSPTHHVDISHGHVLTPTPSLLTTVINGCRRPSRHVAITHGYVNTSTHQAINSSHHPYVNVSPTQTRSQSLDGVNSTPNNGNANGPPVGGQTGQPRQE
NLSSVNNESFPHHTNWVMSSSLMRRAHVNWEQENFHHVVKIMSPHSIL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10034942 0 1
Lus10002099 4.0 1.0000
AT1G17930 Aminotransferase-like, plant m... Lus10005495 5.7 1.0000
Lus10011594 6.9 1.0000
AT4G17920 RING/U-box superfamily protein... Lus10030972 8.0 1.0000
AT2G42850 CYP718 "cytochrome P450, family 718",... Lus10031391 8.9 1.0000
AT1G61290 ATSYP124, SYP12... syntaxin of plants 124 (.1) Lus10006735 9.8 1.0000
Lus10000325 10.5 1.0000
AT1G52540 Protein kinase superfamily pro... Lus10006985 10.6 1.0000
Lus10032121 11.0 1.0000
AT5G18880 RNA-directed DNA polymerase (r... Lus10018808 11.3 1.0000

Lus10034942 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.