Lus10034957 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G28850 160 / 3e-48 ATXTH26, XTH26, XTR18 xyloglucan endotransglucosylase/hydrolase 26 (.1)
AT2G14620 125 / 1e-34 XTH10, XTR14 xyloglucan endotransglucosylase/hydrolase 10 (.1)
AT4G37800 121 / 3e-33 XTH7, XTR15 xyloglucan endotransglucosylase/hydrolase 7 (.1)
AT3G23730 120 / 9e-33 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
AT5G65730 117 / 1e-31 XTH6, XTR10 xyloglucan endotransglucosylase/hydrolase 6 (.1)
AT5G48070 117 / 1e-31 XTH20, ATXTH20 xyloglucan endotransglucosylase/hydrolase 20 (.1)
AT4G30290 115 / 4e-31 XTH19, ATXTH19 xyloglucan endotransglucosylase/hydrolase 19 (.1)
AT4G03210 115 / 4e-31 XTH9, EXGT-A6, XTR16 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
AT4G25810 115 / 4e-31 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
AT5G57560 114 / 9e-31 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012978 264 / 1e-88 AT4G28850 359 / 3e-125 xyloglucan endotransglucosylase/hydrolase 26 (.1)
Lus10011112 234 / 3e-77 AT4G28850 365 / 1e-127 xyloglucan endotransglucosylase/hydrolase 26 (.1)
Lus10043232 232 / 6e-76 AT4G28850 241 / 3e-78 xyloglucan endotransglucosylase/hydrolase 26 (.1)
Lus10035654 132 / 2e-37 AT2G14620 437 / 6e-156 xyloglucan endotransglucosylase/hydrolase 10 (.1)
Lus10010938 128 / 7e-36 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10010939 127 / 9e-36 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10031393 127 / 2e-35 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10011597 125 / 9e-35 AT5G65730 469 / 7e-169 xyloglucan endotransglucosylase/hydrolase 6 (.1)
Lus10031392 124 / 2e-34 AT3G23730 384 / 3e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G084300 212 / 2e-68 AT4G28850 403 / 1e-142 xyloglucan endotransglucosylase/hydrolase 26 (.1)
Potri.006G160700 209 / 2e-67 AT4G28850 390 / 9e-138 xyloglucan endotransglucosylase/hydrolase 26 (.1)
Potri.002G060500 130 / 7e-37 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060400 129 / 2e-36 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.009G083800 127 / 1e-35 AT2G14620 454 / 1e-162 xyloglucan endotransglucosylase/hydrolase 10 (.1)
Potri.018G094900 126 / 3e-35 AT4G25810 410 / 8e-146 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.005G201200 124 / 3e-34 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.018G095200 123 / 5e-34 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.005G201250 123 / 6e-34 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.018G094800 122 / 9e-34 AT4G25810 413 / 1e-146 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10034957 pacid=23181404 polypeptide=Lus10034957 locus=Lus10034957.g ID=Lus10034957.BGIv1.0 annot-version=v1.0
ATGAGTGCTAGCCACCTTCGACGATCCAGTTCTATACTCGACAAAGAATGGACGATGAAGACCCAACTCTTACGAGTGATGACCCAGCTCCGACGAGCCA
ACTACCCACCTCCGATGATCCAGTTATCTGCTCGACGAAGAATCAACTATGAAGACCCAGCTCTTATGATTGACGATTCAGATCGGACGAAGCGACTATT
ACCCTCATCCGACGAGGCGACGACCCAGTTTCTGATTGAACGAAGGCGAGATCGACGACCAGAGACTGGGTTGTATGTGGACAGTGTGCCGATCAGGGTT
TACTGCAACTACGAGAGTGAAGGGATCCCTTACCCAAACAAACAAGGGATGCGAGCTTACTCCAGCTTCTGGAATGCTGATAACTGGGCAACTCGAGGAG
GATTGGATAAGATTGACTGGACCTCCGCTCCCTTCATAGCTAGGTACTGCAACTTCGATGCACGGGCCTGCAAGTGGAATGGTCCTGCCAGCATCGACCA
ATGTGCTCTCGATACCCCAGTTAACTGGTGGACATCTCCTGAGCACAAACAGCTGAGCTATGCTAAGCAAGGGCAGATGAAATGGGCAACAGACAGTTGC
ATGATCTATGACTACTGCACCGATTGCGAGAGATTCAACGGCAACATGCCACCTGAATGCTTCAAGCCACAATACTAA
AA sequence
>Lus10034957 pacid=23181404 polypeptide=Lus10034957 locus=Lus10034957.g ID=Lus10034957.BGIv1.0 annot-version=v1.0
MSASHLRRSSSILDKEWTMKTQLLRVMTQLRRANYPPPMIQLSARRRINYEDPALMIDDSDRTKRLLPSSDEATTQFLIERRRDRRPETGLYVDSVPIRV
YCNYESEGIPYPNKQGMRAYSSFWNADNWATRGGLDKIDWTSAPFIARYCNFDARACKWNGPASIDQCALDTPVNWWTSPEHKQLSYAKQGQMKWATDSC
MIYDYCTDCERFNGNMPPECFKPQY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G28850 ATXTH26, XTH26,... xyloglucan endotransglucosylas... Lus10034957 0 1
AT3G57270 BG1 "beta-1,3-glucanase 1", beta-1... Lus10031033 1.0 1.0000
AT1G70780 unknown protein Lus10039287 2.0 1.0000
Lus10027606 3.0 0.9842
AT2G14440 Leucine-rich repeat protein ki... Lus10005049 3.5 0.9713
AT3G08710 TRXH9, ATH9 THIOREDOXIN TYPE H 9, thioredo... Lus10012859 3.7 0.9067
AT4G37840 HKL3 hexokinase-like 3 (.1) Lus10011584 3.9 0.9279
AT1G71450 AP2_ERF Integrase-type DNA-binding sup... Lus10041050 4.2 0.9262
AT4G39830 Cupredoxin superfamily protein... Lus10000871 4.9 0.8337
AT5G24130 unknown protein Lus10001061 4.9 0.8848
AT1G30710 FAD-binding Berberine family p... Lus10023369 5.2 0.8552

Lus10034957 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.