Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G35190 492 / 1e-176 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT3G46490 451 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G46480 371 / 2e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G46500 362 / 2e-126 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G16770 302 / 1e-101 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G16765 258 / 2e-85 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT3G50210 147 / 3e-41 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT3G49630 137 / 1e-37 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G19010 134 / 2e-36 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT3G49620 134 / 4e-36 DIN11 DARK INDUCIBLE 11, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012963 [exp] 677 / 0 AT1G35190 498 / 7e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10011126 [exp] 521 / 0 AT1G35190 415 / 3e-146 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10043026 [exp] 503 / 6e-180 AT1G35190 408 / 8e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10004746 [exp] 296 / 3e-99 AT4G16770 370 / 7e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10007820 [exp] 231 / 7e-74 AT4G16770 291 / 4e-98 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10021002 [exp] 143 / 1e-39 AT3G19000 389 / 3e-135 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10018836 [exp] 110 / 1e-27 AT5G51310 348 / 7e-120 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10023851 [exp] 110 / 3e-27 AT3G19000 474 / 9e-169 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10004387 [exp] 108 / 1e-26 AT3G11180 509 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G086900 [exp] 596 / 0 AT1G35190 478 / 6e-171 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.018G086800 [exp] 554 / 0 AT1G35190 451 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.003G079600 [exp] 319 / 1e-108 AT4G16770 359 / 1e-124 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.007G047100 [exp] 140 / 6e-39 AT3G50210 503 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) Potri.004G146000 [exp] 140 / 1e-38 AT3G19000 357 / 3e-122 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.004G146100 [exp] 140 / 3e-38 AT3G19000 374 / 5e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.009G107600 [exp] 114 / 4e-29 AT3G19000 459 / 4e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.004G022800 [exp] 112 / 5e-28 AT4G21200 441 / 7e-156 ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 8, gibberellin 2-oxidase 8 (.1.2.3) Potri.019G014454 [exp] 111 / 5e-28 AT5G08640 454 / 1e-161 flavonol synthase 1 (.1.2) Potri.011G026700 [exp] 111 / 6e-28 AT4G21200 444 / 1e-157 ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 8, gibberellin 2-oxidase 8 (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [flax] [poplar] Cupin PF03171 [flax] [poplar] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence Show only first row Show all	>Lus10034964 pacid=23181346 polypeptide=Lus10034964 locus=Lus10034964.g ID=Lus10034964.BGIv1.0 annot-version=v1.0 ATGGAGAAGATTCAAGAGCAGCAGCAGCACCAAGGAAACATTGTCTCTGTACTGAATTGCATCGATCTATCTAGCACGGACCTCCAAAATTCCGTTTCCT TACTCAAACAGGCGTGCTTGGACTGTGGATTTTTCTACGTCGTGAATCACGGGATAAGCCGAGAATTCACGGCGGAGGTTTTTTCACAGAGCAGGAACTT CTTCGAATTGCCAGGGAACGAGAAGATGAAGGTTCTGAGGAACGAAAAGCATCGAGGTTACACTCCGGAGCTGGACGAGCTTTTGGATCCTCAGAATCAA GTTCACGGAGACTATAAGGAGGGCTATTACATTGGAGTGGAGGTTCCTGAAGATAATCCTGAAGCAGACCAACCATTTTATGGGCCAAATGTTTGGCCAT CCTCAGACCTCTTACCGGGTTGGAGGGAAACCATGGAAAAATTTCATCAGCAAGCTCTAGATGTGGCAAGAAAGGTTGCAAGAATTATAGCTCTTGCACT TGATCTAGAAGCTGATTTCTTTGATAAACCGGGGATGCTTGGCCAGCCCATTGCAGTAATGCGGCTGCTGCACTATAGTGGTCAGGTTTCTGATCCCTCG AAGGGATTATATGGAGCTGGTGCCCATTCTGACTATGGTTTGATTACCCTCCTTGCCACTGATGACATCTACGGACTCCAAATATGCAAGGACAAGGACG CTCAACCTCAAGTATGGGAATATTTAGCTCCAATGCAAGGAGCTTTCGTTGTAAATCTTGGTGACATGTTGGAACGCTGGAGCAACTGTATTTTCAAGTC CACATTACATAGGGTTCTAGGAAACGGGCAAGAGAGATATTCCATCGCATACTTCGTGGAACCAAGTCATGATTGTCTTGTAGAATGCTTGCCAACATGT AAATCAGAGGCAAATCCTCCAAAATTTCCACCAATCAAATGCAGCGCATACCTGAGCCAACGCTACAAGGACACCCATGCGGATTTGAGTGTTTACGAAC AGAAGCAACATACATGA
AA sequence Show only first row Show all	>Lus10034964 pacid=23181346 polypeptide=Lus10034964 locus=Lus10034964.g ID=Lus10034964.BGIv1.0 annot-version=v1.0 MEKIQEQQQHQGNIVSVLNCIDLSSTDLQNSVSLLKQACLDCGFFYVVNHGISREFTAEVFSQSRNFFELPGNEKMKVLRNEKHRGYTPELDELLDPQNQ VHGDYKEGYYIGVEVPEDNPEADQPFYGPNVWPSSDLLPGWRETMEKFHQQALDVARKVARIIALALDLEADFFDKPGMLGQPIAVMRLLHYSGQVSDPS KGLYGAGAHSDYGLITLLATDDIYGLQICKDKDAQPQVWEYLAPMQGAFVVNLGDMLERWSNCIFKSTLHRVLGNGQERYSIAYFVEPSHDCLVECLPTC KSEANPPKFPPIKCSAYLSQRYKDTHADLSVYEQKQHT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G35190			2-oxoglutarate (2OG) and Fe(II...		Lus10034964 [exp]	0	1
AT1G01040		SIN1, EMB76, EM...	SHORT INTEGUMENTS 1, EMBRYO DE...		Lus10005141 [exp]	8.2	0.7730
AT1G49950	MYB	ATTRB1, TRB1	telomere repeat binding factor...		Lus10012092 [exp]	10.2	0.7893
AT1G53025			Ubiquitin-conjugating enzyme f...		Lus10042852 [exp]	13.5	0.7988
AT1G76730			NagB/RpiA/CoA transferase-like...		Lus10018870 [exp]	15.6	0.7792
AT5G05980		ATDFB, FPGS1	folylpolyglutamate synthetase ...		Lus10030161 [exp]	29.7	0.7363
AT4G00330		CRCK2	calmodulin-binding receptor-li...		Lus10017787 [exp]	30.0	0.7628
AT2G29350		SAG13	senescence-associated gene 13 ...		Lus10040737 [exp]	30.9	0.7580
AT1G16540		ACI2, ABA3, SIR...	SIRTINOL RESISTANT 3, LOW OSMO...		Lus10031768 [exp]	31.4	0.7424
AT2G20410			RNA-binding ASCH domain protei...		Lus10014656 [exp]	31.6	0.7729
AT4G17030		ATHEXPBETA3.1, ...	expansin-like B1 (.1)		Lus10011012 [exp]	33.7	0.7539

Compare expression of checked genes

Lus10034964 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.