Lus10034969 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G15850 125 / 2e-35 JB67, FADB, ADS3, FAD5 FATTY ACID DESATURASE B, fatty acid desaturase 5 (.1)
AT1G06080 122 / 5e-35 ADS1 delta 9 desaturase 1 (.1)
AT3G15870 122 / 2e-34 Fatty acid desaturase family protein (.1)
AT2G31360 117 / 6e-33 ADS2 16:0delta9 desaturase 2 (.1)
AT1G06120 114 / 8e-32 Fatty acid desaturase family protein (.1)
AT1G06100 112 / 4e-31 Fatty acid desaturase family protein (.1)
AT1G06090 110 / 1e-30 Fatty acid desaturase family protein (.1)
AT1G06360 104 / 2e-28 Fatty acid desaturase family protein (.1)
AT1G06350 99 / 3e-26 Fatty acid desaturase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009470 187 / 9e-61 AT3G15850 358 / 7e-124 FATTY ACID DESATURASE B, fatty acid desaturase 5 (.1)
Lus10001273 161 / 5e-49 AT3G15850 142 / 1e-38 FATTY ACID DESATURASE B, fatty acid desaturase 5 (.1)
Lus10001279 157 / 2e-48 AT3G15850 387 / 2e-134 FATTY ACID DESATURASE B, fatty acid desaturase 5 (.1)
Lus10009469 157 / 3e-48 AT3G15850 391 / 4e-136 FATTY ACID DESATURASE B, fatty acid desaturase 5 (.1)
Lus10017773 154 / 3e-47 AT3G15850 380 / 4e-132 FATTY ACID DESATURASE B, fatty acid desaturase 5 (.1)
Lus10011488 151 / 2e-45 AT3G15850 461 / 5e-163 FATTY ACID DESATURASE B, fatty acid desaturase 5 (.1)
Lus10041043 146 / 6e-44 AT3G15850 372 / 1e-128 FATTY ACID DESATURASE B, fatty acid desaturase 5 (.1)
Lus10041042 144 / 4e-43 AT3G15850 374 / 3e-129 FATTY ACID DESATURASE B, fatty acid desaturase 5 (.1)
Lus10023128 144 / 1e-42 AT3G15850 458 / 1e-161 FATTY ACID DESATURASE B, fatty acid desaturase 5 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G151700 144 / 6e-43 AT3G15850 423 / 7e-148 FATTY ACID DESATURASE B, fatty acid desaturase 5 (.1)
Potri.011G152100 143 / 2e-42 AT3G15850 427 / 2e-149 FATTY ACID DESATURASE B, fatty acid desaturase 5 (.1)
Potri.011G151800 142 / 7e-42 AT3G15850 425 / 1e-148 FATTY ACID DESATURASE B, fatty acid desaturase 5 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00487 FA_desaturase Fatty acid desaturase
Representative CDS sequence
>Lus10034969 pacid=23181428 polypeptide=Lus10034969 locus=Lus10034969.g ID=Lus10034969.BGIv1.0 annot-version=v1.0
ATGGAAGGCCAATTGAGTAGTAGTTACAAATGGGGACTATGGGGCAAGATTGCAGCCGTATACATAACGGCGACGCATCTGCTTGCACTTTGCTCGCTGT
TTTGCTTCAGCCGGGCTGCGTTTTGGGTTGCGATTTCGATTGGAGTCATCACGGGACTCTTCGGCATCAACCTCTCTTACCACAGGCATCTCACCCACAA
GAGCTTCAAGATCCCAAAGTGGCTCGAGTACTTCTTCGCTTACCTTGGCGTTCATGCTCTTCAGGGAGATCCTATATTTTGGGTTAGCAACCACAGGTTT
CATCACCAATACAGCGACACGAGAAAAGACCCACATAGCCCTAATTTAGGGTTTTGGTAG
AA sequence
>Lus10034969 pacid=23181428 polypeptide=Lus10034969 locus=Lus10034969.g ID=Lus10034969.BGIv1.0 annot-version=v1.0
MEGQLSSSYKWGLWGKIAAVYITATHLLALCSLFCFSRAAFWVAISIGVITGLFGINLSYHRHLTHKSFKIPKWLEYFFAYLGVHALQGDPIFWVSNHRF
HHQYSDTRKDPHSPNLGFW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G15850 JB67, FADB, ADS... FATTY ACID DESATURASE B, fatty... Lus10034969 0 1
AT1G29670 GDSL-like Lipase/Acylhydrolase... Lus10012001 1.0 0.8966
AT3G18830 ATPMT5, AtPLT5 ARABIDOPSIS THALIANA POLYOL/MO... Lus10006971 1.4 0.8743
Lus10022658 3.7 0.7314
AT3G05060 NOP56-like pre RNA processing ... Lus10007265 5.5 0.7381
Lus10010245 6.9 0.7304
Lus10013529 9.2 0.7578
AT2G15220 Plant basic secretory protein ... Lus10019802 9.3 0.7625
AT5G13920 GRF zinc finger / Zinc knuckle... Lus10020975 13.3 0.6330
AT2G48020 Major facilitator superfamily ... Lus10029629 13.4 0.7088
AT5G33340 CDR1 CONSTITUTIVE DISEASE RESISTANC... Lus10024903 15.1 0.7368

Lus10034969 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.