Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G29120 132 / 2e-39 6-phosphogluconate dehydrogenase family protein (.1) AT1G71170 41 / 1e-05 6-phosphogluconate dehydrogenase family protein (.1) AT1G71180 38 / 0.0002 6-phosphogluconate dehydrogenase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034977 [exp] 153 / 6e-50 AT4G29120 232 / 2e-77 6-phosphogluconate dehydrogenase family protein (.1) Lus10012950 [exp] 148 / 6e-46 AT4G29120 456 / 3e-163 6-phosphogluconate dehydrogenase family protein (.1) Lus10015455 [exp] 59 / 7e-12 AT1G71180 243 / 2e-78 6-phosphogluconate dehydrogenase family protein (.1) Lus10001349 [exp] 57 / 4e-11 AT1G71180 335 / 4e-115 6-phosphogluconate dehydrogenase family protein (.1) Lus10002140 [exp] 38 / 0.0003 AT1G18270 1147 / 0.0 ketose-bisphosphate aldolase class-II family protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G088000 [exp] 138 / 1e-41 AT4G29120 463 / 8e-165 6-phosphogluconate dehydrogenase family protein (.1) Potri.001G211500 [exp] 61 / 1e-12 AT1G71180 310 / 2e-105 6-phosphogluconate dehydrogenase family protein (.1) Potri.015G037000 [exp] 37 / 0.0004 AT1G18270 1931 / 0.0 ketose-bisphosphate aldolase class-II family protein (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034975 pacid=23181410 polypeptide=Lus10034975 locus=Lus10034975.g ID=Lus10034975.BGIv1.0 annot-version=v1.0 ATGGAGAGGGATTTCCAACCTGGGTTTTATGTGAATCATTTTGTCAAGGATTTGGGCATCTGTTTGAAAGAGTGTCAGAATATGGGACTTGTTTTGCCTG GTTTGGCTTTAGCTCAGCAGCTTTATCTGTCGCTGAAGGCTCACGGGGAAGGCAATTTGGGCACCCACGCTTTGATTTTGGCTCTGGAGAGGCTTAACAA TGTTTCCCTGGCCAACTCTGCAGCTTGA
AA sequence Show only first row Show all	>Lus10034975 pacid=23181410 polypeptide=Lus10034975 locus=Lus10034975.g ID=Lus10034975.BGIv1.0 annot-version=v1.0 MERDFQPGFYVNHFVKDLGICLKECQNMGLVLPGLALAQQLYLSLKAHGEGNLGTHALILALERLNNVSLANSAA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G29120			6-phosphogluconate dehydrogena...		Lus10034975 [exp]	0	1
AT1G32410			Vacuolar protein sorting 55 (V...		Lus10006605 [exp]	1.7	0.8819
AT5G64510		TIN1	tunicamycin induced 1, unknown...		Lus10012458 [exp]	3.5	0.8756
AT1G73500		ATMKK9	MAP kinase kinase 9 (.1)		Lus10040128 [exp]	5.9	0.8532
AT4G19950			unknown protein		Lus10038358 [exp]	6.3	0.8639
AT1G61740			Sulfite exporter TauE/SafE fam...		Lus10020068 [exp]	7.5	0.8722
AT4G00860		AT0ZI1, ATOZI1	Arabidopsis thaliana ozone-ind...		Lus10012194 [exp]	11.7	0.8036
AT2G39770		VTC1, SOZ1, GMP...	VITAMIN C DEFECTIVE 1, SENSITI...		Lus10010880 [exp]	12.2	0.8369
AT3G46450			SEC14 cytosolic factor family ...		Lus10004952 [exp]	13.0	0.8126
					Lus10018015 [exp]	14.0	0.8312
AT2G45630			D-isomer specific 2-hydroxyaci...		Lus10041393 [exp]	16.9	0.8362

Compare expression of checked genes

Lus10034975 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.