Lus10034981 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G19730 176 / 6e-55 Pectin lyase-like superfamily protein (.1)
AT5G47500 60 / 2e-11 PME5 pectin methylesterase 5, Pectin lyase-like superfamily protein (.1)
AT2G36710 50 / 1e-07 Pectin lyase-like superfamily protein (.1)
AT5G55590 47 / 6e-07 QRT1 QUARTET 1, Pectin lyase-like superfamily protein (.1)
AT1G05310 45 / 3e-06 Pectin lyase-like superfamily protein (.1)
AT3G29090 43 / 2e-05 PME31, ATPME31 A. THALIANA PECTIN METHYLESTERASE 31, pectin methylesterase 31 (.1)
AT1G23200 39 / 0.0005 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012942 213 / 5e-69 AT5G19730 594 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10043035 175 / 9e-55 AT5G19730 555 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10011132 176 / 2e-54 AT5G19730 575 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10041815 90 / 6e-22 AT5G19730 446 / 1e-156 Pectin lyase-like superfamily protein (.1)
Lus10028364 88 / 2e-21 AT5G19730 437 / 4e-154 Pectin lyase-like superfamily protein (.1)
Lus10004720 61 / 1e-11 AT5G47500 519 / 0.0 pectin methylesterase 5, Pectin lyase-like superfamily protein (.1)
Lus10009997 54 / 4e-09 AT5G19730 320 / 1e-107 Pectin lyase-like superfamily protein (.1)
Lus10010470 49 / 2e-07 AT1G05310 521 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10041699 48 / 6e-07 AT3G29090 527 / 0.0 A. THALIANA PECTIN METHYLESTERASE 31, pectin methylesterase 31 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G068400 181 / 6e-57 AT5G19730 603 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.007G015700 121 / 7e-34 AT5G19730 472 / 2e-167 Pectin lyase-like superfamily protein (.1)
Potri.003G076900 69 / 2e-14 AT5G47500 554 / 0.0 pectin methylesterase 5, Pectin lyase-like superfamily protein (.1)
Potri.014G117100 50 / 7e-08 AT5G19730 320 / 3e-107 Pectin lyase-like superfamily protein (.1)
Potri.006G120100 50 / 1e-07 AT2G36710 449 / 3e-157 Pectin lyase-like superfamily protein (.1)
Potri.016G017700 48 / 4e-07 AT1G05310 511 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.008G104800 47 / 9e-07 AT3G17060 477 / 5e-170 Pectin lyase-like superfamily protein (.1)
Potri.004G128820 45 / 3e-06 AT3G29090 562 / 0.0 A. THALIANA PECTIN METHYLESTERASE 31, pectin methylesterase 31 (.1)
Potri.001G365700 41 / 0.0001 AT5G55590 429 / 1e-149 QUARTET 1, Pectin lyase-like superfamily protein (.1)
Potri.006G134500 40 / 0.0003 AT4G33220 677 / 0.0 A. THALIANA PECTIN METHYLESTERASE 44, pectin methylesterase 44 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0268 Pec_lyase-like PF01095 Pectinesterase Pectinesterase
Representative CDS sequence
>Lus10034981 pacid=23181341 polypeptide=Lus10034981 locus=Lus10034981.g ID=Lus10034981.BGIv1.0 annot-version=v1.0
ATGAAGTGGGTCCATTTCGTTGGCAGCTTAAAGCATTCGGTCTTCAAAGTAGCCAAGAACAAGCTCTTCCCATCTTTTACCCTCACCGTCGACAAGAACC
CTGTCGTCGGTGACTTCACCTCCATTCAGGACGCCGCTGACTCCCTCCCTTTCGTCAATCTTGCGAGAGTGTTGATCAAGGTCCATGCAGGAGGAGAAAG
TAAACATACCACAATAGAAGGAGAAGGAGCTGACAAGACAATAGTAGAATGGGAGGACACTGCTCAAACCCCTGGCCCTAAGGGTCAGCCAATGGGAATC
TACGCTTCCGCCACGTTTGCAGTCAACTCCCCGTTTTTCATCGCCAGAAACATCACTTTCAGAAGGTTACTAAAAGACGCCCTGAAATTTGAATTAAACG
ATGCATTATATTTGTTATGA
AA sequence
>Lus10034981 pacid=23181341 polypeptide=Lus10034981 locus=Lus10034981.g ID=Lus10034981.BGIv1.0 annot-version=v1.0
MKWVHFVGSLKHSVFKVAKNKLFPSFTLTVDKNPVVGDFTSIQDAADSLPFVNLARVLIKVHAGGESKHTTIEGEGADKTIVEWEDTAQTPGPKGQPMGI
YASATFAVNSPFFIARNITFRRLLKDALKFELNDALYLL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G19730 Pectin lyase-like superfamily ... Lus10034981 0 1
Lus10021453 1.7 0.9678
AT2G38560 RDO2, TFIIS REDUCED DORMANCY 2, transcript... Lus10034247 2.4 0.9153
AT4G36950 MAPKKK21 mitogen-activated protein kina... Lus10034246 2.4 0.9437
Lus10015310 3.0 0.9401
AT2G36800 UGT73C5, DOGT1 UDP-GLUCOSYL TRANSFERASE 73C5,... Lus10023938 3.6 0.8756
AT1G65390 ATPP2-A5 phloem protein 2 A5 (.1.2) Lus10018301 4.7 0.8869
AT3G01680 SEOR1, SEOb Sieve-Element-Occlusion-Relate... Lus10000546 5.3 0.9027
AT1G30370 DLAH DAD1-like acylhydrolase, alpha... Lus10038525 5.5 0.8887
AT3G45070 P-loop containing nucleoside t... Lus10003068 6.9 0.8861
AT3G06060 TSC10A TSC10A, NAD(P)-binding Rossman... Lus10039502 7.2 0.9202

Lus10034981 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.