Lus10034993 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012932 96 / 3e-25 AT3G13570 174 / 1e-53 SC35-like splicing factor 30A (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G006400 43 / 2e-05 AT3G13570 170 / 3e-52 SC35-like splicing factor 30A (.1)
PFAM info
Representative CDS sequence
>Lus10034993 pacid=23181349 polypeptide=Lus10034993 locus=Lus10034993.g ID=Lus10034993.BGIv1.0 annot-version=v1.0
ATGAGGACAAGGGAGCGGGGGAGTAGGGGAGGTGGAGGAGGTCGACCTCGTGATAGGAGGTGGTCCCCTCGTTATTCCCGCTCACCGCGATACTCTCGTT
CGCCTCCACGTCGTGCAAGGTCGCGGTCTCGTAGCCGTGATTATTCCCCACCTGCAAAACAAAGGGACTACTTTAGATCTGTTTCACCCCAAGAGAGAAG
GGTTAGCAAAGAGAGAGCATACTCTCGTTCGAGGAGCCGTAGCCTAACACCAAGAGGAGCTCCAAGCGAGGGTGTCGTTAGGAGCCGAAGTCTCAGCCGC
AGCCGCAGCCCTCCTAGGAGGAGCAGAAGCGCAGCAAATCATGATGAGGACGATTACCCCAGGGAGCGCAACGAGGATCGATCTCCAAGCCCGTGA
AA sequence
>Lus10034993 pacid=23181349 polypeptide=Lus10034993 locus=Lus10034993.g ID=Lus10034993.BGIv1.0 annot-version=v1.0
MRTRERGSRGGGGGRPRDRRWSPRYSRSPRYSRSPPRRARSRSRSRDYSPPAKQRDYFRSVSPQERRVSKERAYSRSRSRSLTPRGAPSEGVVRSRSLSR
SRSPPRRSRSAANHDEDDYPRERNEDRSPSP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10034993 0 1
AT4G22320 unknown protein Lus10032566 1.0 0.9220
AT1G32360 C3HZnF Zinc finger (CCCH-type) family... Lus10004573 1.4 0.8977
Lus10030724 2.2 0.8739
AT1G30320 Remorin family protein (.1) Lus10023284 20.3 0.8801
AT2G33845 Nucleic acid-binding, OB-fold-... Lus10015411 20.6 0.8370
AT3G02120 hydroxyproline-rich glycoprote... Lus10015381 25.5 0.8216
AT5G48385 FRIGIDA-like protein (.1) Lus10004131 25.6 0.7526
AT4G11410 NAD(P)-binding Rossmann-fold s... Lus10032280 26.5 0.8785
AT4G40045 unknown protein Lus10034155 26.6 0.8029
AT5G49600 Protein of unknown function, D... Lus10017087 28.3 0.8406

Lus10034993 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.