Lus10034995 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G62770 72 / 3e-14 ATATG18A autophagy 18a, Transducin/WD40 repeat-like superfamily protein (.1.3)
AT2G40810 69 / 2e-13 ATATG18C homolog of yeast autophagy 18C (.1.2)
AT3G56440 66 / 3e-12 ATATG18D homolog of yeast autophagy 18 (ATG18) D (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036577 147 / 3e-41 AT3G62770 610 / 0.0 autophagy 18a, Transducin/WD40 repeat-like superfamily protein (.1.3)
Lus10041353 146 / 5e-41 AT3G62770 608 / 0.0 autophagy 18a, Transducin/WD40 repeat-like superfamily protein (.1.3)
Lus10029900 61 / 3e-10 AT3G62770 479 / 2e-168 autophagy 18a, Transducin/WD40 repeat-like superfamily protein (.1.3)
Lus10004501 59 / 7e-10 AT3G62770 493 / 5e-174 autophagy 18a, Transducin/WD40 repeat-like superfamily protein (.1.3)
Lus10015178 59 / 9e-10 AT3G62770 489 / 4e-172 autophagy 18a, Transducin/WD40 repeat-like superfamily protein (.1.3)
Lus10001580 0 / 1 AT2G40810 577 / 0.0 homolog of yeast autophagy 18C (.1.2)
Lus10003694 0 / 1 AT2G40810 580 / 0.0 homolog of yeast autophagy 18C (.1.2)
Lus10031500 0 / 1 AT3G62770 493 / 1e-173 autophagy 18a, Transducin/WD40 repeat-like superfamily protein (.1.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G062800 69 / 3e-13 AT2G40810 609 / 0.0 homolog of yeast autophagy 18C (.1.2)
Potri.013G018400 52 / 2e-07 AT3G62770 496 / 6e-176 autophagy 18a, Transducin/WD40 repeat-like superfamily protein (.1.3)
Potri.005G026600 45 / 2e-05 AT3G62770 491 / 7e-174 autophagy 18a, Transducin/WD40 repeat-like superfamily protein (.1.3)
Potri.002G207865 0 / 1 AT3G62770 596 / 0.0 autophagy 18a, Transducin/WD40 repeat-like superfamily protein (.1.3)
Potri.014G132300 0 / 1 AT3G62770 565 / 0.0 autophagy 18a, Transducin/WD40 repeat-like superfamily protein (.1.3)
PFAM info
Representative CDS sequence
>Lus10034995 pacid=23181347 polypeptide=Lus10034995 locus=Lus10034995.g ID=Lus10034995.BGIv1.0 annot-version=v1.0
ATGAGGACGCACAAACCTCCTGATTCAGGCGCCGCCAACATCCTCACCGTCAACATCCCACCGACATCTCACCACCACATCAACGTCTGGACACCAACAA
CACCAATGGAAGAACCAAATCACTGCCGCAACATTCTAGCCGTCAAGCAACCAACGCCAACAAACCAAACTCAAAGAACACCAAGAACATTATCAACATC
ATTATCAGAAAACCCGATCAAAACCATCATCATCAGAAAACCCAATCAAAGACATGTGTCTCATCGTAGAGCTGTCAGCAAAAAAATATCAAACGGTTTC
GGATTATCCTTTGAAATAGGGCAATCGACATCAATAGTCTCGAGGATACAATCATGGCGACTCTTTCTGCTTACTCATCTCCTCCGCCAGCAGGACGGCG
ACGAACAACATCTCGACCATCCCCACCCTTACAATTCCCTATCCTGGGTCATACCTCCGGAGCATCACCACCAACCGGATCAGATTGTCCAGTATGCTAG
CCCCGTCTCTTCTCTTCCCGAGTCATCGTCGTCCCCTCCCCCTCCTGTTTCTCACCTCCATCTCTTATTCAACCAGGACTCTGGCTGCTTCGCCTCCGGC
ACCGATCACGGCTTCCGAATCTACAACTACGATCCCTTCGGGGAGATATTCCGCCGGGACTTCGATCGGCGTGGGCGCGGAATCGGAGTCGTGGAGATGC
TTTTCCGCTGTAACATTTTGGCTCTCGTTGGCGGTGGTTATGATTTGGGACGATCATCAGAGTCGATGCATTGGCGAGCTCTCGTTTAG
AA sequence
>Lus10034995 pacid=23181347 polypeptide=Lus10034995 locus=Lus10034995.g ID=Lus10034995.BGIv1.0 annot-version=v1.0
MRTHKPPDSGAANILTVNIPPTSHHHINVWTPTTPMEEPNHCRNILAVKQPTPTNQTQRTPRTLSTSLSENPIKTIIIRKPNQRHVSHRRAVSKKISNGF
GLSFEIGQSTSIVSRIQSWRLFLLTHLLRQQDGDEQHLDHPHPYNSLSWVIPPEHHHQPDQIVQYASPVSSLPESSSSPPPPVSHLHLLFNQDSGCFASG
TDHGFRIYNYDPFGEIFRRDFDRRGRGIGVVEMLFRCNILALVGGGYDLGRSSESMHWRALV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G62770 ATATG18A autophagy 18a, Transducin/WD40... Lus10034995 0 1
AT4G10020 ATHSD5 hydroxysteroid dehydrogenase 5... Lus10001280 3.6 1.0000
Lus10011061 6.6 1.0000
Lus10022145 7.7 1.0000
AT1G26480 GF14IOTA, GRF12 general regulatory factor 12 (... Lus10026660 11.8 1.0000
Lus10024550 12.0 1.0000
Lus10034512 14.0 1.0000
AT5G49720 TSD1, IRX2, DEC... TUMOROUS SHOOT DEVELOPMENT 1, ... Lus10028619 14.7 1.0000
Lus10008049 15.0 1.0000
AT4G03230 S-locus lectin protein kinase ... Lus10036313 17.0 1.0000
AT1G22260 AtZYP1a, ZYP1a Myosin heavy chain-related pro... Lus10019419 17.9 1.0000

Lus10034995 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.