Lus10035004 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G19790 263 / 4e-92 SNARE-like superfamily protein (.1)
AT1G47830 119 / 2e-35 SNARE-like superfamily protein (.1)
AT2G17380 117 / 2e-34 AP19 associated protein 19 (.1)
AT4G35410 117 / 2e-34 Clathrin adaptor complex small chain family protein (.1.2)
AT3G50860 107 / 1e-30 Clathrin adaptor complex small chain family protein (.1)
AT1G60970 39 / 0.0004 SNARE-like superfamily protein (.1)
AT4G08520 39 / 0.0004 SNARE-like superfamily protein (.1)
AT3G09800 38 / 0.001 SNARE-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012924 276 / 1e-97 AT2G19790 280 / 6e-99 SNARE-like superfamily protein (.1)
Lus10024337 116 / 4e-33 AT1G47830 274 / 5e-95 SNARE-like superfamily protein (.1)
Lus10026316 112 / 3e-32 AT2G17380 297 / 7e-105 associated protein 19 (.1)
Lus10042352 112 / 4e-32 AT2G17380 297 / 3e-104 associated protein 19 (.1)
Lus10003641 103 / 7e-29 AT4G35410 251 / 8e-87 Clathrin adaptor complex small chain family protein (.1.2)
Lus10041742 84 / 5e-21 AT3G50860 278 / 6e-97 Clathrin adaptor complex small chain family protein (.1)
Lus10024011 82 / 3e-20 AT3G50860 215 / 3e-72 Clathrin adaptor complex small chain family protein (.1)
Lus10037624 43 / 1e-05 AT4G08520 287 / 3e-100 SNARE-like superfamily protein (.1)
Lus10006883 43 / 1e-05 AT4G08520 287 / 3e-100 SNARE-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G149100 268 / 3e-94 AT2G19790 287 / 1e-101 SNARE-like superfamily protein (.1)
Potri.005G238701 117 / 1e-34 AT1G47830 275 / 8e-97 SNARE-like superfamily protein (.1)
Potri.012G052000 117 / 1e-34 AT2G17380 307 / 6e-109 associated protein 19 (.1)
Potri.002G022900 116 / 2e-34 AT1G47830 278 / 6e-98 SNARE-like superfamily protein (.1)
Potri.014G079000 115 / 1e-33 AT4G35410 291 / 1e-102 Clathrin adaptor complex small chain family protein (.1.2)
Potri.002G001800 113 / 2e-32 AT2G17380 278 / 3e-97 associated protein 19 (.1)
Potri.007G025400 100 / 1e-27 AT3G50860 296 / 1e-104 Clathrin adaptor complex small chain family protein (.1)
Potri.005G122900 96 / 9e-26 AT3G50860 286 / 1e-100 Clathrin adaptor complex small chain family protein (.1)
Potri.003G043200 38 / 0.0006 AT1G60970 288 / 4e-101 SNARE-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0431 PF PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Representative CDS sequence
>Lus10035004 pacid=23181338 polypeptide=Lus10035004 locus=Lus10035004.g ID=Lus10035004.BGIv1.0 annot-version=v1.0
ATGGTGAACAAGCAAGGCCAGACTCGTCTTGCTCAATACTACGAATGGCTCACTCTCGAAGAGCGCCGTGCCATCGAAGGCGAAATCGTCCGCAAGTGCC
TCGCCCGCAACGAACAACAGTGTTCCTTCGTTGAGCACCGGAATTACAAGATCGTGTACAGGAGATACGCATCGCTGTTTTTCTTGGTTGGAGTTGGCAA
TGACGAGAATGAGCTTGCAATTTTGGAATTCATACATCTGTTAGTGGAAACCATGGACCGTCATTTTGGCAATGTGTGTGAGCTAGACATCATGTTCCAT
TTAGAGAAAGCACATTTCATGCTGGAAGAGATGGTCATGAATGGTTGCATTGTTGAGACGAGCAAATCCAACATCCTCATCCCCATACAGTTGATAGAGA
AAATGTCCTAA
AA sequence
>Lus10035004 pacid=23181338 polypeptide=Lus10035004 locus=Lus10035004.g ID=Lus10035004.BGIv1.0 annot-version=v1.0
MVNKQGQTRLAQYYEWLTLEERRAIEGEIVRKCLARNEQQCSFVEHRNYKIVYRRYASLFFLVGVGNDENELAILEFIHLLVETMDRHFGNVCELDIMFH
LEKAHFMLEEMVMNGCIVETSKSNILIPIQLIEKMS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G19790 SNARE-like superfamily protein... Lus10035004 0 1
AT2G29960 CYP19-4, ATCYP5... CYCLOPHILIN 19-4, ARABIDOPSIS ... Lus10018238 1.4 0.8905
AT5G03460 unknown protein Lus10023922 2.6 0.8967
AT1G35620 ATPDI8, ATPDIL5... ARABIDOPSIS THALIANA PROTEIN D... Lus10022494 4.9 0.8778
AT3G03070 NADH-ubiquinone oxidoreductase... Lus10039147 4.9 0.8659
AT4G26965 NADH:ubiquinone oxidoreductase... Lus10032642 4.9 0.8599
AT4G01710 ARPC5, CRK CROOKED, ARP2/3 complex 16 kDa... Lus10028192 5.0 0.8758
AT5G11680 unknown protein Lus10027000 11.1 0.8832
AT5G03460 unknown protein Lus10014419 12.0 0.8741
AT1G61780 postsynaptic protein-related (... Lus10007644 15.7 0.8577
AT2G23940 Protein of unknown function (D... Lus10041903 16.4 0.8531

Lus10035004 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.