Plant FIBer expression Database

Lus10035013 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G05370 75 / 4e-20 Cytochrome b-c1 complex, subunit 8 protein (.1)
AT3G10860 74 / 2e-19 Cytochrome b-c1 complex, subunit 8 protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021674
[exp]
115 / 3e-36 AT5G05370 75 / 3e-20 Cytochrome b-c1 complex, subunit 8 protein (.1)
Lus10019118
[exp]
82 / 9e-23 AT3G10860 96 / 2e-28 Cytochrome b-c1 complex, subunit 8 protein (.1)
Lus10034442
[exp]
82 / 1e-22 AT3G10860 115 / 6e-36 Cytochrome b-c1 complex, subunit 8 protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G159700
[exp]
79 / 2e-21 AT3G10860 120 / 8e-38 Cytochrome b-c1 complex, subunit 8 protein (.1)
Potri.019G132000
[exp]
78 / 4e-21 AT5G05370 124 / 3e-39 Cytochrome b-c1 complex, subunit 8 protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0429 UcrQ-like PF10890 Cyt_b-c1_8 Cytochrome b-c1 complex subunit 8
Representative CDS sequence
>Lus10035013 pacid=23162557 polypeptide=Lus10035013 locus=Lus10035013.g ID=Lus10035013.BGIv1.0 annot-version=v1.0
ATGGCGAAGGTGAGAATGAGAGCCGTGATCTACGCGCTGTCCCCATTCCAGCAGACGACGATGTCCGGCCTCTATAGAGAACTGCCTTCCAAGATCCACC
ACAAGGTCTTCGACAATTGGCACGGCGTATCCCTCCTCTTCGCCCCTCTCATCGGCGTCTACTCGTAA
AA sequence
>Lus10035013 pacid=23162557 polypeptide=Lus10035013 locus=Lus10035013.g ID=Lus10035013.BGIv1.0 annot-version=v1.0
MAKVRMRAVIYALSPFQQTTMSGLYRELPSKIHHKVFDNWHGVSLLFAPLIGVYS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G05370 Cytochrome b-c1 complex, subun... Lus10035013
[exp]
0 1
AT2G31390 STH pfkB-like carbohydrate kinase ... Lus10039195
[exp]
5.5 0.8197
AT1G23420 YABBY INO, YAB4 INNER NO OUTER, Plant-specific... Lus10030596
[exp]
7.0 0.8298
AT2G19590 ATACO1, ACO1 ACC oxidase 1 (.1) Lus10032683
[exp]
10.7 0.8184
AT3G54490 RPB5E "RNA polymerase II fifth large... Lus10039554
[exp]
13.4 0.7997
Lus10022721
[exp]
13.8 0.8165
AT5G48540 receptor-like protein kinase-r... Lus10025875
[exp]
15.5 0.8171
AT1G17180 ATGSTU25 glutathione S-transferase TAU ... Lus10030020
[exp]
20.6 0.8087
AT2G34930 disease resistance family prot... Lus10006945
[exp]
21.9 0.7986
AT5G22460 alpha/beta-Hydrolases superfam... Lus10020604
[exp]
27.4 0.8124
Lus10019796
[exp]
27.6 0.7470

Lus10035013 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.