Plant FIBer expression Database

Lus10035017 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G68552 49 / 7e-09 CPuORF53 conserved peptide upstream open reading frame 53 (.1)
AT1G25472 40 / 2e-05 CPuORF54 conserved peptide upstream open reading frame 54 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021677
[exp]
162 / 2e-53 AT1G68552 50 / 3e-09 conserved peptide upstream open reading frame 53 (.1)
Lus10041455
[exp]
103 / 2e-30 AT1G68552 56 / 2e-11 conserved peptide upstream open reading frame 53 (.1)
Lus10034317
[exp]
101 / 3e-29 AT1G68552 56 / 2e-11 conserved peptide upstream open reading frame 53 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G125700
[exp]
61 / 2e-13 AT1G25472 / conserved peptide upstream open reading frame 54 (.1)
PFAM info
Representative CDS sequence
>Lus10035017 pacid=23162497 polypeptide=Lus10035017 locus=Lus10035017.g ID=Lus10035017.BGIv1.0 annot-version=v1.0
ATGTCGGCTGAGTTTGATTTGGCTGCAGTGCTTGGGTCTTCTTGTATTTCGATTTACTCCGTTAAAGCTATAGATTCTGCTGCCTGCTGCTTCATTTTCT
CCGCCGTGGCCGCTCTCCGTCGTTGCTGTTACACTCACCATAAGCTCCTCTGCTGGGAACAGCAGAGCTCTCTTCTGAGGTCCGCGTCCACCTCGATGCG
TTTGAGGCCAAAACGGACTTCTTCTGGTGTGGAGTGTTTTGGGGGTTTTCATATAAACCGATTCTCTAATTTATTCCTGTTCTTGAGAGGGGGTCTCACT
TGA
AA sequence
>Lus10035017 pacid=23162497 polypeptide=Lus10035017 locus=Lus10035017.g ID=Lus10035017.BGIv1.0 annot-version=v1.0
MSAEFDLAAVLGSSCISIYSVKAIDSAACCFIFSAVAALRRCCYTHHKLLCWEQQSSLLRSASTSMRLRPKRTSSGVECFGGFHINRFSNLFLFLRGGLT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G68552 CPuORF53 conserved peptide upstream ope... Lus10035017
[exp]
0 1
AT1G68552 CPuORF53 conserved peptide upstream ope... Lus10021677
[exp]
1.0 0.9719
AT3G25890 AP2_ERF CRF11 cytokinin response factor 11, ... Lus10035018
[exp]
2.0 0.9497
AT3G25890 AP2_ERF CRF11 cytokinin response factor 11, ... Lus10021678
[exp]
3.0 0.9372
AT1G06950 ATTIC110, TIC11... ARABIDOPSIS THALIANA TRANSLOCO... Lus10026424
[exp]
3.5 0.9363
AT2G02750 Pentatricopeptide repeat (PPR)... Lus10030787
[exp]
4.2 0.9320
AT3G46740 MAR1, TOC75-III... MODIFIER OF ARG1 1, translocon... Lus10004978
[exp]
5.3 0.9289
AT1G49600 ATRBP47A RNA-binding protein 47A (.1) Lus10012071
[exp]
5.7 0.8719
AT3G03710 PDE326, PNP, RI... resistant to inhibition with F... Lus10001331
[exp]
7.1 0.9336
AT3G11460 Pentatricopeptide repeat (PPR)... Lus10022703
[exp]
7.5 0.9167
AT5G11590 AP2_ERF DREB3, TINY2 TINY2, Integrase-type DNA-bind... Lus10002801
[exp]
13.5 0.8123

Lus10035017 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.