Lus10035026 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008502 0 / 1 AT5G44980 69 / 9e-13 F-box/RNI-like/FBD-like domains-containing protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10035026 pacid=23162402 polypeptide=Lus10035026 locus=Lus10035026.g ID=Lus10035026.BGIv1.0 annot-version=v1.0
ATGAGGTTGTCTGGTTTTGCTGACAATGATATCGAAATAGTTGTGCCAAGACTCAGATTCTTCAGCCTTGAATATCCTTGGCCGTGGGACGTCCTAGGAT
TTCCGAATTTCTACCTTCCCTATGTTGATCGTGCACAGGTTTTTGTCTACGATAAAGCTTTTGGCAAGAAATCGTTCGACCATCATTTGAATAAGCTGGT
GTTTAAGACGGTTCGTAAGTTTTGGTACAGAAGCTGTCTTCCTTTACGAATCTGGAGTCCCTGGTTTGTGTATCTGGAAATCCTTCGAAAGTTGTCCATT
ACAGAGTTGAAAGGTCTTCTGGTGGCGAACCAAACTTTAAGCGATTCCGGAGAAGAGTAA
AA sequence
>Lus10035026 pacid=23162402 polypeptide=Lus10035026 locus=Lus10035026.g ID=Lus10035026.BGIv1.0 annot-version=v1.0
MRLSGFADNDIEIVVPRLRFFSLEYPWPWDVLGFPNFYLPYVDRAQVFVYDKAFGKKSFDHHLNKLVFKTVRKFWYRSCLPLRIWSPWFVYLEILRKLSI
TELKGLLVANQTLSDSGEE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10035026 0 1
AT5G49330 MYB PFG3, ATMYB111 PRODUCTION OF FLAVONOL GLYCOSI... Lus10000008 2.2 1.0000
Lus10001123 4.2 1.0000
AT1G54130 AT-RSH3, RSH3, ... RELA/SPOT homolog 3 (.1) Lus10011252 4.5 1.0000
AT1G47550 SEC3A exocyst complex component sec3... Lus10001022 4.7 1.0000
Lus10023352 5.5 1.0000
Lus10026785 5.9 1.0000
AT5G38435 SPH8 S-protein homologue 8 (.1) Lus10029384 6.7 1.0000
Lus10028048 7.5 1.0000
AT3G14040 Pectin lyase-like superfamily ... Lus10039150 7.7 1.0000
AT5G67440 MEL2, NPY3 NAKED PINS IN YUC MUTANTS 3, M... Lus10025193 8.1 1.0000

Lus10035026 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.