Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G62790 130 / 1e-41 NADH-ubiquinone oxidoreductase-related (.1) AT2G47690 130 / 5e-41 NADH-ubiquinone oxidoreductase-related (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021691 [exp] 144 / 1e-46 AT3G62790 143 / 2e-46 NADH-ubiquinone oxidoreductase-related (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G204800 [exp] 136 / 1e-43 AT3G62790 144 / 5e-47 NADH-ubiquinone oxidoreductase-related (.1) Potri.014G129600 [exp] 135 / 3e-43 AT2G47690 153 / 5e-50 NADH-ubiquinone oxidoreductase-related (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0351 [flax] [poplar] CHCH PF10200 [flax] [poplar] Ndufs5 NADH:ubiquinone oxidoreductase, NDUFS5-15kDa
Representative CDS sequence Show only first row Show all	>Lus10035034 pacid=23162556 polypeptide=Lus10035034 locus=Lus10035034.g ID=Lus10035034.BGIv1.0 annot-version=v1.0 ATGGCTTCGGGATGGGGGATCACAGGGAACAAAGGCAGATGCTACGATTTCTGGATCGATTTCAGCGAGTGTATGTCTAAATGCAGAGAGCCCAAGGACT GCGCTTTCCTTCGCGAAGACTACATGGAGTGCCTTCACCATTCCAAAGAGTTCCAACGAAGGAACCGGATCTACAAAGAGGAGCAGCGGAAAATACGAGC TGCAGCCAGACTAGCTAAGGAAGGTGCTGCTGGTGGCGGTGGCGAGAAAGTTAGCCAGCACGCATAG
AA sequence Show only first row Show all	>Lus10035034 pacid=23162556 polypeptide=Lus10035034 locus=Lus10035034.g ID=Lus10035034.BGIv1.0 annot-version=v1.0 MASGWGITGNKGRCYDFWIDFSECMSKCREPKDCAFLREDYMECLHHSKEFQRRNRIYKEEQRKIRAAARLAKEGAAGGGGEKVSQHA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G62790			NADH-ubiquinone oxidoreductase...		Lus10035034 [exp]	0	1
AT3G59280		TXR1	THAXTOMIN A RESISTANT 1, Prote...		Lus10043207 [exp]	1.7	0.8808
AT5G13430			Ubiquinol-cytochrome C reducta...		Lus10041513 [exp]	2.0	0.8335
AT4G23710		VAG2 ,VATG2 ,VH...	vacuolar ATP synthase subunit ...		Lus10021301 [exp]	2.0	0.8390
AT2G02050			NADH-ubiquinone oxidoreductase...		Lus10035094 [exp]	3.5	0.8287
AT3G59380		FTA, PLP, ATFTA...	PLURIPETALA, farnesyltransfera...		Lus10015954 [exp]	3.9	0.8377
AT2G21290			unknown protein		Lus10018053 [exp]	4.2	0.8234
AT5G53650			unknown protein		Lus10032946 [exp]	4.5	0.8315
AT1G14310			Haloacid dehalogenase-like hyd...		Lus10036740 [exp]	5.2	0.7861
AT4G16450			unknown protein		Lus10038803 [exp]	5.5	0.8231
AT5G10550		GTE2	global transcription factor gr...		Lus10020471 [exp]	5.7	0.8191

Compare expression of checked genes

Lus10035034 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.