Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G14870 71 / 1e-16 AtPCR2, PCR2 PLANT CADMIUM RESISTANCE 2 (.1) AT5G35525 71 / 2e-16 PLAC8 family protein (.1) AT3G18460 69 / 2e-15 PLAC8 family protein (.1) AT3G18470 66 / 7e-15 PLAC8 family protein (.1) AT1G14880 66 / 1e-14 AtPCR1, PCR1 PLANT CADMIUM RESISTANCE 1 (.1) AT1G49030 62 / 1e-12 PLAC8 family protein (.1) AT1G68630 57 / 3e-11 PLAC8 family protein (.1) AT1G58320 57 / 5e-11 PLAC8 family protein (.1) AT3G18450 55 / 5e-10 PLAC8 family protein (.1) AT1G52200 53 / 2e-09 PLAC8 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021696 [exp] 121 / 8e-36 AT1G14870 177 / 5e-57 PLANT CADMIUM RESISTANCE 2 (.1) Lus10041474 [exp] 117 / 1e-34 AT1G14870 112 / 3e-32 PLANT CADMIUM RESISTANCE 2 (.1) Lus10034298 [exp] 103 / 6e-29 AT1G14870 160 / 7e-51 PLANT CADMIUM RESISTANCE 2 (.1) Lus10043325 [exp] 67 / 1e-14 AT1G14870 187 / 4e-61 PLANT CADMIUM RESISTANCE 2 (.1) Lus10019478 [exp] 67 / 1e-14 AT1G14870 184 / 7e-60 PLANT CADMIUM RESISTANCE 2 (.1) Lus10004063 [exp] 58 / 1e-11 AT1G68630 132 / 2e-40 PLAC8 family protein (.1) Lus10009036 [exp] 58 / 2e-11 AT1G68630 122 / 2e-36 PLAC8 family protein (.1) Lus10004064 [exp] 59 / 5e-11 AT4G30040 156 / 3e-41 Eukaryotic aspartyl protease family protein (.1) Lus10008890 [exp] 56 / 1e-10 AT1G68630 119 / 6e-35 PLAC8 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G127700 [exp] 94 / 7e-25 AT1G68610 174 / 5e-56 PLANT CADMIUM RESISTANCE 11 (.1) Potri.007G042800 [exp] 84 / 2e-21 AT1G14870 152 / 7e-48 PLANT CADMIUM RESISTANCE 2 (.1) Potri.008G132775 [exp] 82 / 1e-20 AT1G14870 185 / 2e-60 PLANT CADMIUM RESISTANCE 2 (.1) Potri.010G109100 [exp] 82 / 3e-20 AT1G14870 165 / 1e-52 PLANT CADMIUM RESISTANCE 2 (.1) Potri.008G132850 [exp] 80 / 1e-19 AT1G14870 184 / 6e-60 PLANT CADMIUM RESISTANCE 2 (.1) Potri.010G108800 [exp] 80 / 2e-19 AT1G14870 179 / 8e-58 PLANT CADMIUM RESISTANCE 2 (.1) Potri.012G092200 [exp] 78 / 6e-19 AT1G14870 164 / 2e-52 PLANT CADMIUM RESISTANCE 2 (.1) Potri.008G132900 [exp] 78 / 7e-19 AT1G14870 189 / 7e-62 PLANT CADMIUM RESISTANCE 2 (.1) Potri.010G108900 [exp] 76 / 4e-18 AT1G14870 142 / 4e-43 PLANT CADMIUM RESISTANCE 2 (.1) Potri.012G060900 [exp] 60 / 1e-11 AT1G49030 199 / 2e-62 PLAC8 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04749 [flax] [poplar] PLAC8 PLAC8 family
Representative CDS sequence Show only first row Show all	>Lus10035039 pacid=23162485 polypeptide=Lus10035039 locus=Lus10035039.g ID=Lus10035039.BGIv1.0 annot-version=v1.0 ATGACTCGTACCCCCCCGCCGAACTCACAAGCGGCGCCGGCAGCCCCCATGTTCCTAGGCGGCCACCAAGTCAACACCCCACCACCCTCCAGCCTACCTC CTCCCATCGCCTCAGCTAACCCAGCCAATCATCCTCCCGGCTCTCCCTCGCCGTGGTCCACCGGTCTCTGTGATTGTTTCGACGATTGCTTTTCTTGGTG TGCCTGCCTATTCTCGTGCTTCTACACGTCCAAGATGAGAGGCCAGTTTCACTTGGAAGAGAAGCCCTGTGCAGATTGCTGCGTCCATTTGTTTTGCGAA GGGTGTGCTCTTTGCCAGGAGTATCGTGAGCTTACGCACAAAGGATTTGATATGTCCATCGATCAGTTTTAA
AA sequence Show only first row Show all	>Lus10035039 pacid=23162485 polypeptide=Lus10035039 locus=Lus10035039.g ID=Lus10035039.BGIv1.0 annot-version=v1.0 MTRTPPPNSQAAPAAPMFLGGHQVNTPPPSSLPPPIASANPANHPPGSPSPWSTGLCDCFDDCFSWCACLFSCFYTSKMRGQFHLEEKPCADCCVHLFCE GCALCQEYRELTHKGFDMSIDQF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G35525			PLAC8 family protein (.1)		Lus10035039 [exp]	0	1
AT3G07020		UGT80A2, SGT	UDP-glucosyl transferase 80A2,...		Lus10009557 [exp]	1.7	0.9329
					Lus10003879 [exp]	3.9	0.8895
AT1G35670		CPK11, ATCDPK2,...	calcium-dependent protein kina...		Lus10014820 [exp]	4.9	0.8983
					Lus10025164 [exp]	5.5	0.8991
AT3G60720		PDLP8	plasmodesmata-located protein ...		Lus10036497 [exp]	5.8	0.9067
AT4G16950		RPP5	RECOGNITION OF PERONOSPORA PAR...		Lus10020525 [exp]	10.9	0.8829
AT3G02850		SKOR	STELAR K+ outward rectifier, S...		Lus10035498 [exp]	13.0	0.8840
AT3G07880		SCN1	SUPERCENTIPEDE1, Immunoglobuli...		Lus10010491 [exp]	14.8	0.8477
					Lus10041944 [exp]	16.4	0.8739
AT5G01300			PEBP (phosphatidylethanolamine...		Lus10002212 [exp]	17.1	0.8641

Compare expression of checked genes

Lus10035039 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.