Lus10035041 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G68660 247 / 2e-85 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034292 241 / 9e-83 AT1G68660 234 / 3e-80 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2)
Lus10041479 240 / 2e-82 AT1G68660 235 / 1e-80 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G117800 269 / 5e-94 AT1G68660 271 / 1e-94 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2)
Potri.010G128500 258 / 2e-89 AT1G68660 256 / 1e-88 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2)
Potri.010G096600 59 / 2e-11 AT1G68660 60 / 1e-11 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2)
Potri.008G145500 55 / 3e-10 AT1G68660 62 / 8e-13 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02617 ClpS ATP-dependent Clp protease adaptor protein ClpS
Representative CDS sequence
>Lus10035041 pacid=23162548 polypeptide=Lus10035041 locus=Lus10035041.g ID=Lus10035041.BGIv1.0 annot-version=v1.0
ATGGAGACTGCGTTCCGCGGGAGAATCACCCTCTCACCTAATCCCTTCTTCAATCCCAAGCCAGGGGACAGACAGATTCTATGTCGAGGACGATGTAATG
CCCGTGGGATACTCATGGCAGTATCAGCCACAGCAGCGCCAGGTAAAGGAGGAGGATTGTTGGATAAACCAGTGATAGATAAGCCCACTCCTGGCCGTGA
CTCTGAGTTTGACTTAAGGAAATCGAGGAAAATGTCTCCCCCTTACCGTGTGATGCTGCACAATGACGACTTCAACAAACGGGAATACGTAGTCCAAGTG
CTGATGAAGGTGATTCCTGGGATGACACTGGACACTGCAGTGAATATAATGCAGGAGGCACACCACAATGGATTGTCGGTGGTGATAATATGCACTCAGG
CTGACGCGGAGGAGCACTGCACGCAGCTGCGGGGGAACGGGCTCCTGAGTTCAATCGAACCTGCAAGTGGTGGATGTTAA
AA sequence
>Lus10035041 pacid=23162548 polypeptide=Lus10035041 locus=Lus10035041.g ID=Lus10035041.BGIv1.0 annot-version=v1.0
METAFRGRITLSPNPFFNPKPGDRQILCRGRCNARGILMAVSATAAPGKGGGLLDKPVIDKPTPGRDSEFDLRKSRKMSPPYRVMLHNDDFNKREYVVQV
LMKVIPGMTLDTAVNIMQEAHHNGLSVVIICTQADAEEHCTQLRGNGLLSSIEPASGGC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G68660 Ribosomal protein L12/ ATP-dep... Lus10035041 0 1
AT3G24315 ATSEC20 Sec20 family protein (.1) Lus10014460 1.0 0.8872
AT1G29530 unknown protein Lus10025373 4.0 0.8555
AT5G35460 unknown protein Lus10021569 4.0 0.8782
AT3G08890 Protein of unknown function, D... Lus10002862 4.5 0.8531
AT5G39250 F-box family protein (.1) Lus10032969 4.5 0.8593
AT3G26100 Regulator of chromosome conden... Lus10006455 4.9 0.8502
AT1G08970 CCAAT NF-YC9, HAP5C "nuclear factor Y, subunit C9"... Lus10004468 6.7 0.8681
AT3G47300 SELT SELT-like protein precursor (.... Lus10040658 6.9 0.8583
AT1G51200 A20/AN1-like zinc finger famil... Lus10031262 7.0 0.8571
AT3G05670 RING/U-box protein (.1) Lus10000086 8.8 0.7803

Lus10035041 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.