Lus10035046 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021702 194 / 2e-62 AT4G17410 140 / 1e-36 DWNN domain, a CCHC-type zinc finger (.1.2.3)
Lus10034393 112 / 3e-30 AT5G47430 186 / 4e-52 DWNN domain, a CCHC-type zinc finger (.1.2.3)
Lus10029205 86 / 8e-21 AT5G47430 175 / 2e-48 DWNN domain, a CCHC-type zinc finger (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G156000 47 / 1e-06 AT5G47430 620 / 0.0 DWNN domain, a CCHC-type zinc finger (.1.2.3)
Potri.003G078800 47 / 1e-06 AT5G47430 635 / 0.0 DWNN domain, a CCHC-type zinc finger (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF08783 DWNN DWNN domain
Representative CDS sequence
>Lus10035046 pacid=23162477 polypeptide=Lus10035046 locus=Lus10035046.g ID=Lus10035046.BGIv1.0 annot-version=v1.0
ATGTCGTCGATGACAGTGCGTTACAAGTTTATGAGTGAGAAGGATTTCCACGATATCCGATTTCCAGAGCGTTACACGACTGTCCGCGATCTGAAATTGG
CAATTTTCAATTCTAGATTCAAAGATAAATATAATAATAAAAATAGTCAGTATCTTAGTATCTGGAACGGCTGCTGTTTAGGAACTGATCACGATCTTCA
CATCATCGATTCCAAAACGAACACCCCGTATAAGAACGACTCCGCTCTGATCTCCGATCAAGCCGCCGTTTTAATCTGCCGCGTCGCAGGCGATCGCGAG
CGGCGGCTCCTGGACACTGAGCCCATCGATTTACGGCCACAACGAGAAGCCGATTCCGAAAGAGTAGCAGTACTAGTACTTGTAGAGTAG
AA sequence
>Lus10035046 pacid=23162477 polypeptide=Lus10035046 locus=Lus10035046.g ID=Lus10035046.BGIv1.0 annot-version=v1.0
MSSMTVRYKFMSEKDFHDIRFPERYTTVRDLKLAIFNSRFKDKYNNKNSQYLSIWNGCCLGTDHDLHIIDSKTNTPYKNDSALISDQAAVLICRVAGDRE
RRLLDTEPIDLRPQREADSERVAVLVLVE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10035046 0 1
AT2G46150 Late embryogenesis abundant (L... Lus10027177 3.5 0.9238
AT3G14620 CYP72A8 "cytochrome P450, family 72, s... Lus10026681 4.2 0.9232
AT4G11650 ATOSM34 osmotin 34 (.1) Lus10005140 4.8 0.8568
AT2G23600 ATMES2, ACL, AT... ARABIDOPSIS THALIANA METHYL ES... Lus10012854 4.9 0.9238
AT3G04720 HEL, PR-4, PR4 HEVEIN-LIKE, pathogenesis-rela... Lus10013728 6.0 0.9238
AT4G37330 CYP81D4 "cytochrome P450, family 81, s... Lus10024817 6.9 0.9238
Lus10026928 7.7 0.9238
AT3G07680 emp24/gp25L/p24 family/GOLD fa... Lus10006360 9.5 0.9202
AT2G21200 SAUR-like auxin-responsive pro... Lus10008992 9.5 0.8649
AT5G42905 Polynucleotidyl transferase, r... Lus10034950 9.5 0.9119

Lus10035046 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.