Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G21580 145 / 1e-46 Ribosomal protein S25 family protein (.1.2) AT4G39200 145 / 2e-46 Ribosomal protein S25 family protein (.1.2) AT4G34555 139 / 2e-44 Ribosomal protein S25 family protein (.1) AT2G16360 131 / 1e-40 Ribosomal protein S25 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021706 [exp] 155 / 1e-50 AT4G39200 161 / 7e-53 Ribosomal protein S25 family protein (.1.2) Lus10034277 [exp] 150 / 1e-48 AT2G21580 157 / 3e-51 Ribosomal protein S25 family protein (.1.2) Lus10023552 [exp] 149 / 6e-48 AT4G39200 169 / 7e-56 Ribosomal protein S25 family protein (.1.2) Lus10040436 [exp] 136 / 2e-43 AT4G39200 130 / 3e-41 Ribosomal protein S25 family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G157200 [exp] 139 / 2e-44 AT4G39200 135 / 1e-42 Ribosomal protein S25 family protein (.1.2) Potri.009G118900 [exp] 139 / 2e-44 AT4G39200 135 / 1e-42 Ribosomal protein S25 family protein (.1.2) Potri.008G020000 [exp] 139 / 4e-44 AT4G34555 132 / 2e-41 Ribosomal protein S25 family protein (.1) Potri.010G239300 [exp] 137 / 1e-43 AT4G39200 131 / 6e-41 Ribosomal protein S25 family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0123 [flax] [poplar] HTH PF03297 [flax] [poplar] Ribosomal_S25 S25 ribosomal protein
Representative CDS sequence Show only first row Show all	>Lus10035060 pacid=23162394 polypeptide=Lus10035060 locus=Lus10035060.g ID=Lus10035060.BGIv1.0 annot-version=v1.0 ATGGCTCCAAAGAAGGCAGCTCCACCGCCGTCGTCGAAGCCGGCCAAGTCCGGAGGAGGGAAGCAGAAGAAGAAGAAGTGGAGCAAGGGAAAGCAAAAGG AGAAGGTGAACAACATGGTTCTCTTCGATCAGGCTACCTATGACAAGCTGCTCACTGAAGCTCCCAAGTACAAGCACATCACTCCTTCCATCCTCTCCGA TCGCCTCAGGATTAATGGATCGTTGGCAAGGAAGGCAATAAGGGAGCTGATGGCAAAGGGTTTGATCAGGATGGTCTCAGCTCACTCAAGCCAGCAGATT TACACCAGGGCTACAAACACCTGA
AA sequence Show only first row Show all	>Lus10035060 pacid=23162394 polypeptide=Lus10035060 locus=Lus10035060.g ID=Lus10035060.BGIv1.0 annot-version=v1.0 MAPKKAAPPPSSKPAKSGGGKQKKKKWSKGKQKEKVNNMVLFDQATYDKLLTEAPKYKHITPSILSDRLRINGSLARKAIRELMAKGLIRMVSAHSSQQI YTRATNT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G39200			Ribosomal protein S25 family p...		Lus10035060 [exp]	0	1
AT5G04800			Ribosomal S17 family protein (...		Lus10021307 [exp]	1.0	0.9109
AT3G61110		ARS27A	ribosomal protein S27 (.1)		Lus10031974 [exp]	2.0	0.8892
AT5G62300			Ribosomal protein S10p/S20e fa...		Lus10038910 [exp]	5.5	0.8554
AT3G07590			Small nuclear ribonucleoprotei...		Lus10016068 [exp]	6.0	0.8636
AT5G23740		RPS11-BETA	ribosomal protein S11-beta (.1...		Lus10005348 [exp]	6.3	0.8676
AT5G23740		RPS11-BETA	ribosomal protein S11-beta (.1...		Lus10041029 [exp]	6.5	0.8762
AT5G08180			Ribosomal protein L7Ae/L30e/S1...		Lus10010993 [exp]	7.2	0.8469
AT3G54560		HTA11	histone H2A 11 (.1)		Lus10003088 [exp]	8.2	0.8348
AT3G16080			Zinc-binding ribosomal protein...		Lus10011446 [exp]	10.0	0.8711
AT2G03530		ATUPS2, UPS2	ARABIDOPSIS THALIANA UREIDE PE...		Lus10036911 [exp]	10.2	0.8568

Compare expression of checked genes

Lus10035060 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.