Lus10035077 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G61470 162 / 1e-47 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G44240 154 / 3e-45 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G27820 155 / 6e-45 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G06450 156 / 8e-45 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G80780 153 / 2e-44 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
AT2G32070 151 / 8e-44 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G27890 151 / 2e-43 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT5G10960 149 / 7e-43 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G15920 147 / 3e-42 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2)
AT5G22250 139 / 6e-39 AtCAF1b CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017905 585 / 0 AT1G06450 162 / 5e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10001651 559 / 0 AT1G61470 167 / 4e-49 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10008043 529 / 0 AT1G06450 165 / 5e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10000561 509 / 0 AT1G61470 143 / 1e-40 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10035078 408 / 9e-144 AT1G06450 168 / 2e-49 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10000327 396 / 8e-139 AT1G06450 174 / 1e-51 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10038113 342 / 5e-119 AT3G44240 140 / 3e-41 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10017895 269 / 7e-91 AT1G06450 98 / 4e-26 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10017894 248 / 4e-83 AT1G06450 47 / 8e-07 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G038700 202 / 6e-63 AT1G61470 182 / 8e-56 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.003G181100 157 / 6e-46 AT1G80780 468 / 1e-168 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
Potri.001G046700 157 / 7e-46 AT2G32070 472 / 2e-170 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.018G020900 152 / 8e-44 AT2G32070 441 / 2e-158 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G187200 148 / 2e-42 AT2G32070 403 / 2e-143 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G262500 146 / 1e-41 AT2G32070 443 / 5e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G205600 143 / 3e-40 AT5G22250 302 / 4e-103 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.016G073000 140 / 2e-39 AT3G44260 322 / 5e-111 CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.009G161500 137 / 4e-38 AT5G22250 387 / 1e-136 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.004G200400 134 / 3e-37 AT5G22250 419 / 3e-149 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0219 RNase_H PF04857 CAF1 CAF1 family ribonuclease
Representative CDS sequence
>Lus10035077 pacid=23162369 polypeptide=Lus10035077 locus=Lus10035077.g ID=Lus10035077.BGIv1.0 annot-version=v1.0
ATGGCTGTGAGGGAAGTCTGGAACCATAATTTCGATCAAGAGCTCCACGCCATGGAAGTCTGTTTGAGAAGCTACACAGTAGTGTCCGTCGACACAGAAT
TCCCAGGTTGCCTCCGTCCGACACCGAGGTACGCTTCCGAGGAACTCCGATTTCAGAACTTGAAGTACAACGTCGGCGCTACCTCTCTGATTCAATTAGG
GCTCACTCTCTGTAATTCCGAGGGCACCGTCGGCGGAATCTGGCAATTCAATTTCCAATTCGACCTAGACCACGACCTACACTCCAAAGATTCCACCGAT
TTCTTGGCCCTCCACGGAATCGATTTCCTGAAATTGAAAACCCACGGTGTTGACCGGGTCAGATTCGGCGCCATGTTCGGAGCGGTGATTCGGAGAAGGC
GGAGTGCGATTACGTGGATCACTTTCCACGGAGTTTACGATTACGCCTATCTCGTGAAGGCGGTGAGTTTCCGTCCAGTTGCGGAATCATCGGCGGAATT
CGTTAATTTTTTGGGGATCGGGTTTGATTCGGTGGTGGATTGCAAGTATATGGCTAAGTTGTATGAGGAGACCGGTAGTGAAATTGGGTTGCAGAAGTTA
GCGGATGCTTTGGGGGTGAAGAGAAGAGGGGAAGCTCATACTGCCGCCTCTGATAGTTTCTTGACGGCGCTCGTTTACTTTGAGTTGAAGAAGAAACTGA
TGCTGTTGGGTGTTGATGAAGAGTCTTACGTTGACTACGTCTATGGAATCAGCACCAAAATCTCCAGGAAGCAGAAAGAGCCCCTCTTTCTACCAACTGC
TCGGCCAGCAGGTCCTCCTGTGTATCATCATCATCCTTATCCTCATCTTTATCAGAGCAATTTGCTGTATCCCATTCCATATCAGCAGCAAAGAGTAGCC
TTGCCTCCAAATGTGATGATGGGTCGTCGTTGGGTTGATTGCTCATTAGCTCCAACAGTATTAGTTCCTTCTTTCATCTACTGA
AA sequence
>Lus10035077 pacid=23162369 polypeptide=Lus10035077 locus=Lus10035077.g ID=Lus10035077.BGIv1.0 annot-version=v1.0
MAVREVWNHNFDQELHAMEVCLRSYTVVSVDTEFPGCLRPTPRYASEELRFQNLKYNVGATSLIQLGLTLCNSEGTVGGIWQFNFQFDLDHDLHSKDSTD
FLALHGIDFLKLKTHGVDRVRFGAMFGAVIRRRRSAITWITFHGVYDYAYLVKAVSFRPVAESSAEFVNFLGIGFDSVVDCKYMAKLYEETGSEIGLQKL
ADALGVKRRGEAHTAASDSFLTALVYFELKKKLMLLGVDEESYVDYVYGISTKISRKQKEPLFLPTARPAGPPVYHHHPYPHLYQSNLLYPIPYQQQRVA
LPPNVMMGRRWVDCSLAPTVLVPSFIY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G61470 Polynucleotidyl transferase, r... Lus10035077 0 1
AT1G61470 Polynucleotidyl transferase, r... Lus10000561 6.4 0.6877
AT5G56130 THO3, AtTEX1 Transducin/WD40 repeat-like su... Lus10027113 6.7 0.7564
AT3G18430 Calcium-binding EF-hand family... Lus10022173 7.9 0.7655
AT4G33630 EX1 EXECUTER1, Protein of unknown ... Lus10020435 14.0 0.7539
AT2G46220 Uncharacterized conserved prot... Lus10012651 15.1 0.7570
AT1G66140 C2H2ZnF ZFP4 zinc finger protein 4 (.1) Lus10030764 15.9 0.7262
AT4G01400 unknown protein Lus10012607 24.4 0.7278
AT1G16250 Galactose oxidase/kelch repeat... Lus10013899 29.3 0.7361
AT2G46220 Uncharacterized conserved prot... Lus10010135 29.6 0.7509
AT4G19985 Acyl-CoA N-acyltransferases (N... Lus10028990 32.1 0.7552

Lus10035077 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.