Lus10035078 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G06450 168 / 2e-49 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G61470 159 / 8e-47 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G27820 154 / 2e-44 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G44240 151 / 3e-44 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G15920 152 / 4e-44 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2)
AT2G32070 151 / 6e-44 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT5G10960 149 / 3e-43 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G80780 149 / 5e-43 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
AT1G27890 146 / 8e-42 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT5G22250 140 / 1e-39 AtCAF1b CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000327 549 / 0 AT1G06450 174 / 1e-51 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10017905 428 / 2e-151 AT1G06450 162 / 5e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10001651 429 / 8e-151 AT1G61470 167 / 4e-49 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10008043 423 / 1e-149 AT1G06450 165 / 5e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10035077 408 / 8e-144 AT1G61470 162 / 6e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10000561 400 / 5e-141 AT1G61470 143 / 1e-40 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10038113 321 / 1e-110 AT3G44240 140 / 3e-41 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10007771 234 / 9e-76 AT1G61470 170 / 5e-51 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10029713 229 / 9e-74 AT5G10960 144 / 4e-41 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G038700 211 / 1e-66 AT1G61470 182 / 8e-56 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.001G046700 152 / 2e-44 AT2G32070 472 / 2e-170 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.003G181100 152 / 3e-44 AT1G80780 468 / 1e-168 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
Potri.006G205600 147 / 4e-42 AT5G22250 302 / 4e-103 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.018G020900 145 / 2e-41 AT2G32070 441 / 2e-158 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.016G073000 143 / 2e-40 AT3G44260 322 / 5e-111 CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G262500 142 / 2e-40 AT2G32070 443 / 5e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.009G161500 140 / 1e-39 AT5G22250 387 / 1e-136 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G187200 139 / 3e-39 AT2G32070 403 / 2e-143 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.004G200400 136 / 4e-38 AT5G22250 419 / 3e-149 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0219 RNase_H PF04857 CAF1 CAF1 family ribonuclease
Representative CDS sequence
>Lus10035078 pacid=23162510 polypeptide=Lus10035078 locus=Lus10035078.g ID=Lus10035078.BGIv1.0 annot-version=v1.0
ATGGGTTTTCTCGTGAGGGAAGTCTGGGACGAAAATCTCCGTCAAGAATTGAAAGCCATGGAAGAATGTCTGGCCAAGTACTCAGTCGTATCGGTGGACT
CCGAATTCCCAGGCTTCCTCTGTCCGACGCCCAGGTACGCTTCCGAGGAGCTTCGATTTGAGAACTTGAAGTACAACGTCGGCCAAACCTCTCTCATCCA
ATTAGGTCTGACTCTCTCCAACACAAAAGGCACCGTCGGCGGTATCTGGCAGTTCAATTTCCAATTCGACCAAGACAGCGATCTCCACTGCCCAAATTCA
ATCGAATTCTTAATCCTCCACGGGATCGATTTCAACAGGCTCAAAACCCACGGGATTGACCGGGTTAAATTCGGCACGGCGTTCGGAAGGCTGATTGCGA
GAAGGAAAAGTTCGATTACGTGGATCACTTTCCACGGAGTATACGACCTCGCCCATATTGTGAAAGCGGTGAGTTTCCGTCCGGTTGCGGAATCGTCGGC
GGAATTCGTTGGCGTTTTGGGGAGGGGGTTTGATTCAGTGGTGGATGTGAAATACATGGCTAAGTTTTATGAAGAGACGGGGAGTGAAATTGGATTGCAG
AAGTTAGCTGATAATTTAGGGGTGAAGAGAAGAGGGGAAGCTCATACGGCTGCTTCCGACAGTTTGTTGACGGCGCTGGTTTACTTCAAGCTGAAGAAGA
AGCTGAAGCAGCAGGGGATTGAGGAAAACGTTTACTTTGACTTCGTGTATGGAATCAGTTCCAGAATCTCTAGGGAGTTCATCAATGCTGCTGCTGCGAT
TGCGTATCAGGGGGGTATGGCGTATGCGAATCCGTATTATGAGAGGAATTTGGCTGCGGAATTGATGATGATGGGTCATTGGGATTATTGCTCTGCTACT
GCTGCAACACCAGTGTCATCTCTGATCTATGGATGA
AA sequence
>Lus10035078 pacid=23162510 polypeptide=Lus10035078 locus=Lus10035078.g ID=Lus10035078.BGIv1.0 annot-version=v1.0
MGFLVREVWDENLRQELKAMEECLAKYSVVSVDSEFPGFLCPTPRYASEELRFENLKYNVGQTSLIQLGLTLSNTKGTVGGIWQFNFQFDQDSDLHCPNS
IEFLILHGIDFNRLKTHGIDRVKFGTAFGRLIARRKSSITWITFHGVYDLAHIVKAVSFRPVAESSAEFVGVLGRGFDSVVDVKYMAKFYEETGSEIGLQ
KLADNLGVKRRGEAHTAASDSLLTALVYFKLKKKLKQQGIEENVYFDFVYGISSRISREFINAAAAIAYQGGMAYANPYYERNLAAELMMMGHWDYCSAT
AATPVSSLIYG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G06450 Polynucleotidyl transferase, r... Lus10035078 0 1
AT1G06450 Polynucleotidyl transferase, r... Lus10000327 1.0 0.9803
AT5G22250 AtCAF1b CCR4- associated factor 1b, Po... Lus10034180 1.4 0.9715
AT4G11070 WRKY ATWRKY41, WRKY4... WRKY family transcription fact... Lus10023099 2.4 0.9711
AT4G29780 unknown protein Lus10011946 2.8 0.9684
AT4G34320 Protein of unknown function (D... Lus10011295 3.2 0.9677
AT1G64700 unknown protein Lus10008274 3.5 0.9674
AT4G11070 WRKY ATWRKY41, WRKY4... WRKY family transcription fact... Lus10032372 4.9 0.9652
AT5G38700 unknown protein Lus10001456 5.2 0.9549
AT5G48150 GRAS PAT1 phytochrome a signal transduct... Lus10035840 5.3 0.9659
AT4G00300 fringe-related protein (.1.2) Lus10005120 6.5 0.9463

Lus10035078 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.