Lus10035087 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G18420 134 / 4e-39 Protein prenylyltransferase superfamily protein (.1)
AT2G37400 83 / 1e-19 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G53560 81 / 6e-19 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G02590 81 / 1e-18 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G39470 75 / 1e-16 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G09490 58 / 2e-10 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G78915 40 / 0.0002 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031923 212 / 2e-69 AT3G18420 270 / 2e-89 Protein prenylyltransferase superfamily protein (.1)
Lus10024433 68 / 5e-14 AT2G37400 271 / 1e-89 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10025299 67 / 1e-13 AT2G37400 272 / 3e-89 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10035707 58 / 2e-10 AT4G39470 257 / 3e-84 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G143600 149 / 1e-44 AT3G18420 356 / 4e-123 Protein prenylyltransferase superfamily protein (.1)
Potri.010G098500 142 / 5e-42 AT3G18420 328 / 5e-112 Protein prenylyltransferase superfamily protein (.1)
Potri.008G142980 135 / 2e-41 AT3G18420 244 / 5e-82 Protein prenylyltransferase superfamily protein (.1)
Potri.007G079200 83 / 1e-19 AT4G39470 314 / 5e-106 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.016G080000 82 / 3e-19 AT2G37400 342 / 4e-117 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.006G213600 79 / 3e-18 AT3G53560 327 / 1e-111 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G085700 77 / 2e-17 AT4G39470 296 / 7e-99 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.016G081200 61 / 6e-13 AT3G53560 127 / 2e-37 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.008G003800 40 / 0.0003 AT1G78915 448 / 3e-157 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3)
PFAM info
Representative CDS sequence
>Lus10035087 pacid=23162525 polypeptide=Lus10035087 locus=Lus10035087.g ID=Lus10035087.BGIv1.0 annot-version=v1.0
ATGTGGAGAAGAAATGGTGGTGGGGGCCTTGGCTGCAGTCTGCTGTGTGCGCGACTAAGCCAGCCGCAGGAAGGGGAAGGTGCGGTTTCGAGACTGGAGA
GCGCGTTGCAGATTGCAGAAGAAGAGGAAAATGTGAAGGAAGGTCGTGCGGTGAGGATGATAATGGCGCAGGTGTATTTCTTGCTGAAGAATATGGAGGA
GGCGTTGAAGATATACCATGAGCTGTCTAAGGAGGATCCTCGGGATGTTAGGCCTTATTACTGCAATGGGATCATATACCGTATGCTTAAGAAGAATGAG
GAAGCGAAACGGGAGTTTGCTAAGTATCGAGAGCTGTCGCCTAAGAAAGGTGAGGTTGATGATGCTTACTTGAGGACTGCATTGTCCGGAACGACTACAG
GGTTCGAATCGAATGACAACAACTAA
AA sequence
>Lus10035087 pacid=23162525 polypeptide=Lus10035087 locus=Lus10035087.g ID=Lus10035087.BGIv1.0 annot-version=v1.0
MWRRNGGGGLGCSLLCARLSQPQEGEGAVSRLESALQIAEEEENVKEGRAVRMIMAQVYFLLKNMEEALKIYHELSKEDPRDVRPYYCNGIIYRMLKKNE
EAKREFAKYRELSPKKGEVDDAYLRTALSGTTTGFESNDNN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G18420 Protein prenylyltransferase su... Lus10035087 0 1
AT2G01520 ZCE1, MLP328 \(Zusammen-CA\)-enhanced 1, ML... Lus10028887 2.4 0.8821
AT5G12300 Calcium-dependent lipid-bindin... Lus10001346 2.6 0.8863
AT5G22580 Stress responsive A/B Barrel D... Lus10009407 11.9 0.8597
AT3G48670 RDM12, IDN2 RNA-DIRECTED DNA METHYLATION 1... Lus10002305 13.6 0.8471
AT1G61700 RNA polymerases N / 8 kDa subu... Lus10013128 13.8 0.7586
AT2G34200 RING/FYVE/PHD zinc finger supe... Lus10007293 15.5 0.8224
Lus10040164 15.5 0.7438
AT2G38940 PHT1;4, ATPT2 ARABIDOPSIS THALIANA PHOSPHATE... Lus10024884 15.7 0.6927
AT2G36840 ACR10 ACT domain repeats 10, ACT-lik... Lus10005447 17.0 0.8159
AT1G78380 GST8, ATGSTU19 GLUTATHIONE TRANSFERASE 8, A. ... Lus10026198 17.7 0.8384

Lus10035087 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.