Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G47820 72 / 6e-18 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031924 [exp] 120 / 2e-36 AT1G47820 73 / 5e-18 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G121300 [exp] 93 / 3e-26 AT1G47820 75 / 4e-19 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10035088 pacid=23162578 polypeptide=Lus10035088 locus=Lus10035088.g ID=Lus10035088.BGIv1.0 annot-version=v1.0 ATGGTTCTGCCAGATTGCTGGGTTGAGAGTGGTGTGAGAATGGAGATTGATGGTGATAACAATGGTATCCGTGTTAAGGCCACATTCAGACTTGGCTCAG AATCCCACTCAGTAGCTGCCGGGAAAGGCGATACAATCTCAGAGGAGCTGGTTTCAATGAAGGAAGAAAGCATGAGGATACTCAAGGAGTTCATAACCAA ACATAACGTTCCTGCTGATGTTCCTGATGAGTTAATCGATGATGATGGCTCTGGTGATGAGGACGCAGAAGAGGTTCAAGAGAAACCTCATCTCAAATCC AAGAAGACCAAGCTCACTTGA
AA sequence Show only first row Show all	>Lus10035088 pacid=23162578 polypeptide=Lus10035088 locus=Lus10035088.g ID=Lus10035088.BGIv1.0 annot-version=v1.0 MVLPDCWVESGVRMEIDGDNNGIRVKATFRLGSESHSVAAGKGDTISEELVSMKEESMRILKEFITKHNVPADVPDELIDDDGSGDEDAEEVQEKPHLKS KKTKLT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G47820			unknown protein		Lus10035088 [exp]	0	1
AT2G39960			Microsomal signal peptidase 25...		Lus10014838 [exp]	1.4	0.8740
AT3G18510			unknown protein		Lus10032475 [exp]	1.7	0.8795
AT1G79390			unknown protein		Lus10001838 [exp]	2.0	0.8435
AT3G50830		ATCOR413-PM2, C...	cold-regulated 413-plasma memb...		Lus10023833 [exp]	2.4	0.8541
AT5G49550		BLOS2	BLOC subunit 2, unknown protei...		Lus10019163 [exp]	4.5	0.8049
AT3G06050		PRXIIF, ATPRXII...	peroxiredoxin IIF (.1)		Lus10041218 [exp]	4.9	0.8193
AT5G49060			Heat shock protein DnaJ, N-ter...		Lus10037502 [exp]	5.5	0.7827
AT2G33220			GRIM-19 protein (.1)		Lus10035237 [exp]	6.7	0.8092
AT1G64750		DSS1(I), ATDSS1...	deletion of SUV3 suppressor 1(...		Lus10030583 [exp]	8.7	0.8351
AT1G67620			Lojap-related protein (.1)		Lus10015822 [exp]	9.8	0.8336

Compare expression of checked genes

Lus10035088 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.