Lus10035094 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G02050 161 / 4e-53 NADH-ubiquinone oxidoreductase B18 subunit, putative (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031932 214 / 3e-73 AT2G02050 164 / 4e-53 NADH-ubiquinone oxidoreductase B18 subunit, putative (.1)
Lus10019137 208 / 1e-71 AT2G02050 163 / 5e-54 NADH-ubiquinone oxidoreductase B18 subunit, putative (.1)
Lus10034424 206 / 8e-71 AT2G02050 162 / 3e-53 NADH-ubiquinone oxidoreductase B18 subunit, putative (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G099900 179 / 2e-60 AT2G02050 159 / 2e-52 NADH-ubiquinone oxidoreductase B18 subunit, putative (.1)
Potri.008G141900 178 / 8e-60 AT2G02050 159 / 3e-52 NADH-ubiquinone oxidoreductase B18 subunit, putative (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0351 CHCH PF05676 NDUF_B7 NADH-ubiquinone oxidoreductase B18 subunit (NDUFB7)
Representative CDS sequence
>Lus10035094 pacid=23162438 polypeptide=Lus10035094 locus=Lus10035094.g ID=Lus10035094.BGIv1.0 annot-version=v1.0
ATGGAAGTCCCCGGATCGTCGAAGCCGATGATTGCTACGCAGGCAGAAATGGTGGAAGCTAGAGTCCCCATGGCTTACAGGGACCAGTGCGCTCACCTTT
TGATCCCGCTCAACAAGTGCCGCCAGGCCGAGTTCTATCTGCCCTGGAAGTGCGAGAACGAGCGCCATTCATACGAGAAATGCGAGTACGAGCTTGTCAT
GGAGAGGATGCTCCAGATGCAGAAGATCCGTGAAGACGAGGCCAAGCTCAAAAACCCCAACAAACAGGGAGGTGCCGCAATTGGTCTCATCCCCAAAACT
GCCAACGCGTAG
AA sequence
>Lus10035094 pacid=23162438 polypeptide=Lus10035094 locus=Lus10035094.g ID=Lus10035094.BGIv1.0 annot-version=v1.0
MEVPGSSKPMIATQAEMVEARVPMAYRDQCAHLLIPLNKCRQAEFYLPWKCENERHSYEKCEYELVMERMLQMQKIREDEAKLKNPNKQGGAAIGLIPKT
ANA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G02050 NADH-ubiquinone oxidoreductase... Lus10035094 0 1
AT3G62790 NADH-ubiquinone oxidoreductase... Lus10035034 3.5 0.8287
AT2G02050 NADH-ubiquinone oxidoreductase... Lus10031932 3.7 0.7803
AT1G48440 B-cell receptor-associated 31-... Lus10001080 3.9 0.8289
AT1G48440 B-cell receptor-associated 31-... Lus10040126 4.5 0.8261
AT3G59380 FTA, PLP, ATFTA... PLURIPETALA, farnesyltransfera... Lus10015954 4.9 0.8263
AT3G07680 emp24/gp25L/p24 family/GOLD fa... Lus10016624 5.0 0.8240
AT5G13430 Ubiquinol-cytochrome C reducta... Lus10041513 5.3 0.8082
AT3G52300 ATPQ "ATP synthase D chain, mitocho... Lus10023337 7.3 0.7927
AT5G54750 Transport protein particle (TR... Lus10028720 7.7 0.8135
AT2G41600 Mitochondrial glycoprotein fam... Lus10042042 7.9 0.7462

Lus10035094 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.