Lus10035097 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G48480 146 / 3e-43 Cysteine proteinases superfamily protein (.1)
AT4G33620 61 / 1e-10 Cysteine proteinases superfamily protein (.1)
AT1G60220 60 / 1e-10 ULP1D, OTS1 OVERLY TOLERANT TO SALT 1, UB-like protease 1D (.1)
AT1G09730 55 / 5e-09 Cysteine proteinases superfamily protein (.1.2)
AT1G10570 52 / 5e-08 ULP1C, OTS2 UB-LIKE PROTEASE 1C, OVERLY TOLERANT TO SALT 2, Cysteine proteinases superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031938 202 / 3e-67 AT3G48480 77 / 4e-18 Cysteine proteinases superfamily protein (.1)
Lus10000917 63 / 1e-11 AT1G09730 514 / 1e-169 Cysteine proteinases superfamily protein (.1.2)
Lus10030867 61 / 1e-10 AT1G60220 250 / 2e-76 OVERLY TOLERANT TO SALT 1, UB-like protease 1D (.1)
Lus10020445 59 / 5e-10 AT4G33620 404 / 6e-129 Cysteine proteinases superfamily protein (.1)
Lus10030622 56 / 5e-09 AT1G60220 253 / 7e-77 OVERLY TOLERANT TO SALT 1, UB-like protease 1D (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G090800 198 / 2e-63 AT3G48480 228 / 8e-74 Cysteine proteinases superfamily protein (.1)
Potri.010G180300 174 / 3e-54 AT3G48480 278 / 3e-93 Cysteine proteinases superfamily protein (.1)
Potri.002G105700 69 / 2e-13 AT1G09730 580 / 0.0 Cysteine proteinases superfamily protein (.1.2)
Potri.007G115400 68 / 2e-13 AT1G09730 427 / 3e-135 Cysteine proteinases superfamily protein (.1.2)
Potri.017G044000 66 / 9e-13 AT1G09730 452 / 4e-143 Cysteine proteinases superfamily protein (.1.2)
Potri.005G155600 65 / 4e-12 AT1G09730 551 / 0.0 Cysteine proteinases superfamily protein (.1.2)
Potri.010G040600 55 / 5e-09 AT1G60220 410 / 3e-137 OVERLY TOLERANT TO SALT 1, UB-like protease 1D (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF02902 Peptidase_C48 Ulp1 protease family, C-terminal catalytic domain
Representative CDS sequence
>Lus10035097 pacid=23162572 polypeptide=Lus10035097 locus=Lus10035097.g ID=Lus10035097.BGIv1.0 annot-version=v1.0
ATGAAGATTTCTAAAAAAGAGTTAAAGAGACATCAACTAACATCAATATGTTTCTCAGGTAGTTTCCCCTCTCGCCTGAGATCGAATAGGGCAGCAGCTA
AGCACACGATCGTACGTTCCACCAAAGTGACTCCTCCTCCACAGAAAATGAAGCTAGATAGTGCTCAATTCGATTCATATTTCAAGGGTCACTGGAACCT
CCTGATTCTCTGTAACCTTGGTGAAAGCATGGAGTCCGAGACTGCAGTAAGACCGTGCATGCTATTGCTTGATTCACTTGAGGATGCTGGTCCTAGGCGT
ATTGAACCAGATATAAGGAAGTTTCTGTTTGACATTTACAGATCGGAGGGCAGAGCTGAAACTAAACAGTCAATTCGTAGAATTCCTTTGTTAGTACCAA
AGGTGCCACAGCAAACGAATGATGAAGAATGCGGGAAGTATGTTCTTTATTTCATCCATTTGTTTGTGCAAGGTGCTCCACAGAGTTTCAGCATGGAGGA
CGACTACCCTAACTTTATGACTCGAGACTGGTTCACGCCTCAATGCTTGGAGCATTTCTTTGAGGAATTGGATCCCCTTGAGAAAGCTTGA
AA sequence
>Lus10035097 pacid=23162572 polypeptide=Lus10035097 locus=Lus10035097.g ID=Lus10035097.BGIv1.0 annot-version=v1.0
MKISKKELKRHQLTSICFSGSFPSRLRSNRAAAKHTIVRSTKVTPPPQKMKLDSAQFDSYFKGHWNLLILCNLGESMESETAVRPCMLLLDSLEDAGPRR
IEPDIRKFLFDIYRSEGRAETKQSIRRIPLLVPKVPQQTNDEECGKYVLYFIHLFVQGAPQSFSMEDDYPNFMTRDWFTPQCLEHFFEELDPLEKA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G48480 Cysteine proteinases superfami... Lus10035097 0 1
AT3G07530 unknown protein Lus10040483 1.0 0.8942
AT5G38710 Methylenetetrahydrofolate redu... Lus10003053 4.2 0.8804
AT5G24270 ATSOS3, CBL4, S... CALCINEURIN B-LIKE PROTEIN 4, ... Lus10030252 11.0 0.8926
AT3G07700 Protein kinase superfamily pro... Lus10006363 15.3 0.8640
AT5G66450 Phosphatidic acid phosphatase ... Lus10028328 15.5 0.8790
AT1G30500 CCAAT NF-YA7 "nuclear factor Y, subunit A7"... Lus10023358 15.5 0.8917
AT5G57740 XBAT32 XB3 ortholog 2 in Arabidopsis ... Lus10015503 24.5 0.8717
AT3G01040 GAUT13 galacturonosyltransferase 13 (... Lus10015379 25.8 0.8875
AT1G05410 Protein of unknown function (D... Lus10041201 26.8 0.8916
AT1G10095 Protein prenylyltransferase su... Lus10042569 29.7 0.8812

Lus10035097 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.