Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G14690 118 / 5e-32 MAP65-7 microtubule-associated protein 65-7 (.1.2) AT2G01910 102 / 1e-26 ATMAP65-6 Microtubule associated protein (MAP65/ASE1) family protein (.1), Microtubule associated protein (MAP65/ASE1) family protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035099 [exp] 203 / 2e-63 AT2G01910 822 / 0.0 Microtubule associated protein (MAP65/ASE1) family protein (.1), Microtubule associated protein (MAP65/ASE1) family protein (.2) Lus10031939 [exp] 196 / 8e-61 AT2G01910 838 / 0.0 Microtubule associated protein (MAP65/ASE1) family protein (.1), Microtubule associated protein (MAP65/ASE1) family protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G139700 [exp] 164 / 4e-49 AT2G01910 778 / 0.0 Microtubule associated protein (MAP65/ASE1) family protein (.1), Microtubule associated protein (MAP65/ASE1) family protein (.2) Potri.011G092500 [exp] 40 / 0.0001 AT5G55230 863 / 0.0 microtubule-associated proteins 65-1 (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10035098 pacid=23162492 polypeptide=Lus10035098 locus=Lus10035098.g ID=Lus10035098.BGIv1.0 annot-version=v1.0 ATGGCTTTGTCCAATGTCCATATATACATATTGGAGAGGACGCCATTGATACTCGCTGGAAAACAGAAATTGATGTACGGGTCTAAACCAAGTCCACGAA GGACAAACAGCTTCAGGAAGCCGAACGGTTATCGTGGAAATGGGTCGATGACTCCGACACCACGCCGCAATTCTATATGTGGAACTCCTCCTGAACCCCT CACTCCACGGTCGTATTCAGGGCGGAATAATGGATATTTCAAGGAAATGAGGAGGTTATCAACTACTCCGTTGAACTTTGTGGTGATAACGAAAGAAGAT ACCATGTCATTCGCCTCAATTTCCGGTTCAGAGCCGGGATCCCCTCATAGCTAA
AA sequence Show only first row Show all	>Lus10035098 pacid=23162492 polypeptide=Lus10035098 locus=Lus10035098.g ID=Lus10035098.BGIv1.0 annot-version=v1.0 MALSNVHIYILERTPLILAGKQKLMYGSKPSPRRTNSFRKPNGYRGNGSMTPTPRRNSICGTPPEPLTPRSYSGRNNGYFKEMRRLSTTPLNFVVITKED TMSFASISGSEPGSPHS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G14690		MAP65-7	microtubule-associated protein...		Lus10035098 [exp]	0	1
AT4G11880	MADS	AGL14	AGAMOUS-like 14 (.1)		Lus10006716 [exp]	1.0	0.8866
AT2G36840		ACR10	ACT domain repeats 10, ACT-lik...		Lus10005447 [exp]	2.4	0.8764
AT1G05170			Galactosyltransferase family p...		Lus10039657 [exp]	3.2	0.8583
AT5G08030		AtGDPD6	glycerophosphodiester phosphod...		Lus10021152 [exp]	3.3	0.8546
AT1G78380		GST8, ATGSTU19	GLUTATHIONE TRANSFERASE 8, A. ...		Lus10042470 [exp]	3.5	0.8760
AT5G02800		CDL1	CDG1-like 1, Protein kinase su...		Lus10014019 [exp]	3.6	0.8526
AT4G25440	C3HZnF	ZFWD1	zinc finger WD40 repeat protei...		Lus10021655 [exp]	3.9	0.8729
AT1G67710	GARP	ARR11	response regulator 11 (.1)		Lus10011389 [exp]	4.6	0.8377
AT5G38900			Thioredoxin superfamily protei...		Lus10034369 [exp]	4.9	0.8649
AT1G68800	TCP	TCP12, BRC2, TC...	BRANCHED 2, TCP domain protein...		Lus10042962 [exp]	4.9	0.8780

Compare expression of checked genes

Lus10035098 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.