Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G30480 246 / 2e-81 TPR1, AtTPR1 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3) AT2G42580 72 / 6e-14 VIT, TTL3 VHI-INTERACTING TPR CONTAINING PROTEIN, tetratricopetide-repeat thioredoxin-like 3 (.1) AT3G58620 71 / 1e-13 TTL4 tetratricopetide-repeat thioredoxin-like 4 (.1) AT1G56090 68 / 4e-13 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G65160 66 / 4e-12 TPR14 tetratricopeptide repeat 14, tetratricopeptide repeat (TPR)-containing protein (.1) AT1G53300 66 / 4e-12 TTL1 tetratricopetide-repeat thioredoxin-like 1 (.1) AT3G54010 66 / 7e-12 DEI1, PAS1 PASTICCINO 1, FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1.2) AT1G62390 65 / 1e-11 CLMP1, Phox2 Phox2, CLUMPED CHLOROPLASTS 1, Octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein (.1) AT1G56440 64 / 2e-11 TPR5 tetratricopeptide repeat 5, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT1G62740 64 / 2e-11 Hop2 Hop2, stress-inducible protein, putative (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031983 [exp] 310 / 3e-102 AT4G30480 222 / 9e-76 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3) Lus10029481 [exp] 75 / 7e-15 AT1G62390 889 / 0.0 Phox2, CLUMPED CHLOROPLASTS 1, Octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein (.1) Lus10039592 [exp] 75 / 8e-15 AT1G62390 888 / 0.0 Phox2, CLUMPED CHLOROPLASTS 1, Octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein (.1) Lus10028154 [exp] 72 / 4e-14 AT1G53300 754 / 0.0 tetratricopetide-repeat thioredoxin-like 1 (.1) Lus10042854 [exp] 72 / 5e-14 AT1G53300 749 / 0.0 tetratricopetide-repeat thioredoxin-like 1 (.1) Lus10022603 [exp] 66 / 5e-12 AT3G54010 831 / 0.0 PASTICCINO 1, FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1.2) Lus10008035 [exp] 66 / 7e-12 AT2G25290 667 / 0.0 Phox1, Octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein Lus10038106 [exp] 66 / 8e-12 AT2G25290 655 / 0.0 Phox1, Octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein Lus10022500 [exp] 66 / 8e-12 AT5G65160 652 / 0.0 tetratricopeptide repeat 14, tetratricopeptide repeat (TPR)-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G100700 [exp] 276 / 2e-93 AT4G30480 303 / 8e-104 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3) Potri.006G178900 [exp] 267 / 7e-90 AT4G30480 275 / 1e-92 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3) Potri.011G021000 [exp] 80 / 1e-16 AT1G62390 885 / 0.0 Phox2, CLUMPED CHLOROPLASTS 1, Octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein (.1) Potri.004G002900 [exp] 77 / 7e-16 AT1G62390 926 / 0.0 Phox2, CLUMPED CHLOROPLASTS 1, Octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein (.1) Potri.011G111500 [exp] 73 / 2e-14 AT1G53300 707 / 0.0 tetratricopetide-repeat thioredoxin-like 1 (.1) Potri.006G033400 [exp] 70 / 2e-13 AT5G48570 596 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.005G166300 [exp] 68 / 9e-13 AT5G65160 436 / 5e-145 tetratricopeptide repeat 14, tetratricopeptide repeat (TPR)-containing protein (.1) Potri.002G094800 [exp] 68 / 1e-12 AT5G65160 451 / 2e-152 tetratricopeptide repeat 14, tetratricopeptide repeat (TPR)-containing protein (.1) Potri.005G076800 [exp] 68 / 1e-12 AT5G65160 619 / 0.0 tetratricopeptide repeat 14, tetratricopeptide repeat (TPR)-containing protein (.1) Potri.005G097300 [exp] 67 / 1e-12 AT1G56090 260 / 2e-86 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF07719 [flax] [poplar] TPR_2 Tetratricopeptide repeat CL0020 [flax] [poplar] TPR PF00515 [flax] [poplar] TPR_1 Tetratricopeptide repeat
Representative CDS sequence Show only first row Show all	>Lus10035117 pacid=23162505 polypeptide=Lus10035117 locus=Lus10035117.g ID=Lus10035117.BGIv1.0 annot-version=v1.0 ATGGCTCTGATTGAAGAAGTTCCACACGAAGACAAGAAACAGGAAACTCCCCAAAATTGTTCTCCCGAGAAGCCTAAATCACCGTCGTCAGAGGCCGCTA CAAAAGCAGGAGACACAACTGCTACAACATCCACGGCATCTGGAAGTGCATACGTGAGAGAGAATGACTCGGATGGTTTTGAAACTGCAAGTGAACGTGA TATGAGCGACAATGATGATAATAATCAAGAGGGGCAAAAGCACTGCGACAATGTTGCAAATGATGAAGAAGCAAACCAGGAGAAAGCATTAGCATTGGCC AACGAGGCTAAATTGGAAGGCAATAGACTTTTTGGGGATATGAAGTTTGAGGAGGCACTAGTGCAGTATGACATTGCCTTACAAACTACACCTGACTTGC CCTCTTCTTCGGATCTCAGATCCATATGCCACTCGAACCGTGCTGTATGCTTCTTGAAACTGGGAAAATATGAGGAAACGGTTAAAGAATGCACAAAAGC ACTAGAAATAAATCCTTCATATGTGAAAGCTCTTAGGAGAAGAGGAGAGGCCAACGAAAAGCTTGAGCATTTTGAGGAAGCACTTGCTGATATGAAAAAG ATTCTTGAGTTAGATCCTTCTAATGACTTTGCTCGTCCATCTATTGCTCGCTTGGAGCCATTGGCAGCAGAGAAGCGAGAAAAAATGAAGGAAGAGATGA TTGGGAAGCTGAAGGAGATGGGGAACTCTTTGTTAGGGCGCTTTGGGATGAGCGTGGACAATTTCAAAGCAGTGAAAGATCCAAAGACTGGATCATACTC GGTTTCCTTTCAGAATTAA
AA sequence Show only first row Show all	>Lus10035117 pacid=23162505 polypeptide=Lus10035117 locus=Lus10035117.g ID=Lus10035117.BGIv1.0 annot-version=v1.0 MALIEEVPHEDKKQETPQNCSPEKPKSPSSEAATKAGDTTATTSTASGSAYVRENDSDGFETASERDMSDNDDNNQEGQKHCDNVANDEEANQEKALALA NEAKLEGNRLFGDMKFEEALVQYDIALQTTPDLPSSSDLRSICHSNRAVCFLKLGKYEETVKECTKALEINPSYVKALRRRGEANEKLEHFEEALADMKK ILELDPSNDFARPSIARLEPLAAEKREKMKEEMIGKLKEMGNSLLGRFGMSVDNFKAVKDPKTGSYSVSFQN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G30480		TPR1, AtTPR1	tetratricopeptide repeat 1, Te...		Lus10035117 [exp]	0	1
AT3G07090			PPPDE putative thiol peptidase...		Lus10038168 [exp]	2.4	0.8936
AT3G15610			Transducin/WD40 repeat-like su...		Lus10019450 [exp]	5.3	0.8591
AT1G76060		EMB1793	EMBRYO DEFECTIVE 1793, LYR fam...		Lus10005621 [exp]	9.0	0.8556
AT5G08060			unknown protein		Lus10021149 [exp]	9.6	0.8791
AT5G12020		HSP17.6II	17.6 kDa class II heat shock p...		Lus10026453 [exp]	10.2	0.8786
AT5G48150	GRAS	PAT1	phytochrome a signal transduct...		Lus10006369 [exp]	10.6	0.8584
AT2G03690			coenzyme Q biosynthesis Coq4 f...		Lus10026673 [exp]	12.0	0.8625
AT1G07400			HSP20-like chaperones superfam...		Lus10016456 [exp]	15.5	0.8674
AT1G30070			SGS domain-containing protein ...		Lus10038500 [exp]	19.3	0.8609
AT1G11360			Adenine nucleotide alpha hydro...		Lus10038561 [exp]	19.5	0.8536

Compare expression of checked genes

Lus10035117 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.