Lus10035124 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G55930 70 / 4e-16 ATOPT1 ARABIDOPSIS THALIANA OLIGOPEPTIDE TRANSPORTER 1, oligopeptide transporter 1 (.1)
AT4G26590 68 / 2e-15 ATOPT5 ARABIDOPSIS THALIANA OLIGOPEPTIDE TRANSPORTER 5, oligopeptide transporter 5 (.1)
AT4G16370 63 / 1e-13 ATOPT3 oligopeptide transporter (.1)
AT1G09930 59 / 3e-12 ATOPT2 oligopeptide transporter 2 (.1)
AT4G27730 56 / 4e-11 ATOPT6 ARABIDOPSIS THALIANA OLIGOPEPTIDE TRANSPORTER 6, oligopeptide transporter 1 (.1)
AT5G64410 53 / 4e-10 ATOPT4 ARABIDOPSIS THALIANA OLIGOPEPTIDE TRANSPORTER 4, oligopeptide transporter 4 (.1)
AT4G10770 52 / 7e-10 ATOPT7 ARABIDOPSIS THALIANA OLIGOPEPTIDE TRANSPORTER 7, oligopeptide transporter 7 (.1)
AT5G53520 52 / 1e-09 ATOPT8 oligopeptide transporter 8 (.1)
AT5G53510 45 / 2e-07 ATOPT9 oligopeptide transporter 9 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031978 115 / 7e-32 AT4G26590 1066 / 0.0 ARABIDOPSIS THALIANA OLIGOPEPTIDE TRANSPORTER 5, oligopeptide transporter 5 (.1)
Lus10016632 89 / 1e-22 AT4G26590 981 / 0.0 ARABIDOPSIS THALIANA OLIGOPEPTIDE TRANSPORTER 5, oligopeptide transporter 5 (.1)
Lus10022541 88 / 2e-22 AT4G26590 1066 / 0.0 ARABIDOPSIS THALIANA OLIGOPEPTIDE TRANSPORTER 5, oligopeptide transporter 5 (.1)
Lus10022312 82 / 3e-22 AT4G26590 151 / 1e-43 ARABIDOPSIS THALIANA OLIGOPEPTIDE TRANSPORTER 5, oligopeptide transporter 5 (.1)
Lus10022543 87 / 4e-22 AT4G26590 1084 / 0.0 ARABIDOPSIS THALIANA OLIGOPEPTIDE TRANSPORTER 5, oligopeptide transporter 5 (.1)
Lus10032585 83 / 1e-20 AT4G26590 1020 / 0.0 ARABIDOPSIS THALIANA OLIGOPEPTIDE TRANSPORTER 5, oligopeptide transporter 5 (.1)
Lus10014885 82 / 2e-20 AT4G26590 961 / 0.0 ARABIDOPSIS THALIANA OLIGOPEPTIDE TRANSPORTER 5, oligopeptide transporter 5 (.1)
Lus10043161 82 / 3e-20 AT4G26590 951 / 0.0 ARABIDOPSIS THALIANA OLIGOPEPTIDE TRANSPORTER 5, oligopeptide transporter 5 (.1)
Lus10032586 82 / 4e-20 AT4G26590 1004 / 0.0 ARABIDOPSIS THALIANA OLIGOPEPTIDE TRANSPORTER 5, oligopeptide transporter 5 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G004800 89 / 5e-23 AT4G26590 988 / 0.0 ARABIDOPSIS THALIANA OLIGOPEPTIDE TRANSPORTER 5, oligopeptide transporter 5 (.1)
Potri.006G003700 86 / 1e-21 AT4G26590 863 / 0.0 ARABIDOPSIS THALIANA OLIGOPEPTIDE TRANSPORTER 5, oligopeptide transporter 5 (.1)
Potri.001G369700 82 / 3e-20 AT4G26590 1039 / 0.0 ARABIDOPSIS THALIANA OLIGOPEPTIDE TRANSPORTER 5, oligopeptide transporter 5 (.1)
Potri.001G370100 79 / 3e-19 AT4G26590 1006 / 0.0 ARABIDOPSIS THALIANA OLIGOPEPTIDE TRANSPORTER 5, oligopeptide transporter 5 (.1)
Potri.016G006500 62 / 3e-13 AT4G16370 1305 / 0.0 oligopeptide transporter (.1)
Potri.006G006000 62 / 4e-13 AT4G16370 1284 / 0.0 oligopeptide transporter (.1)
Potri.005G150400 59 / 4e-12 AT5G64410 1106 / 0.0 ARABIDOPSIS THALIANA OLIGOPEPTIDE TRANSPORTER 4, oligopeptide transporter 4 (.1)
Potri.002G109300 58 / 7e-12 AT1G09930 1114 / 0.0 oligopeptide transporter 2 (.1)
Potri.003G145500 55 / 6e-11 AT4G10770 1197 / 0.0 ARABIDOPSIS THALIANA OLIGOPEPTIDE TRANSPORTER 7, oligopeptide transporter 7 (.1)
Potri.009G079500 54 / 2e-10 AT5G64410 1214 / 0.0 ARABIDOPSIS THALIANA OLIGOPEPTIDE TRANSPORTER 4, oligopeptide transporter 4 (.1)
PFAM info
Representative CDS sequence
>Lus10035124 pacid=23162381 polypeptide=Lus10035124 locus=Lus10035124.g ID=Lus10035124.BGIv1.0 annot-version=v1.0
ATGGATGCTGGAGTTGCATTCTTGGCTGTTTTGATTAACTTTGTTCTTCAGGATAAGAATATTTACGGTCCTAAATGGTGGGGGTTAGAAGGTGATGATC
ATTGCCCGTTGGCTACTTGCCCTCCTGCCCCTGGAATGAATGTCACTGGTTGCCCTGTCTTCCATTGA
AA sequence
>Lus10035124 pacid=23162381 polypeptide=Lus10035124 locus=Lus10035124.g ID=Lus10035124.BGIv1.0 annot-version=v1.0
MDAGVAFLAVLINFVLQDKNIYGPKWWGLEGDDHCPLATCPPAPGMNVTGCPVFH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G55930 ATOPT1 ARABIDOPSIS THALIANA OLIGOPEPT... Lus10035124 0 1
AT4G22410 Ubiquitin C-terminal hydrolase... Lus10035548 5.7 0.6807
AT3G59140 ATMRP14, ABCC10 ATP-binding cassette C10, mult... Lus10028741 10.0 0.6314
AT3G44150 unknown protein Lus10021005 14.8 0.6281
Lus10033096 26.8 0.5806
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10021338 27.9 0.5806
AT1G32450 NRT1.5 nitrate transporter 1.5 (.1) Lus10030286 29.0 0.5806
AT1G27220 paired amphipathic helix repea... Lus10000805 30.0 0.5806
AT1G64940 CYP89A6 "cytochrome P450, family 87, s... Lus10010229 34.6 0.5728
AT1G31450 Eukaryotic aspartyl protease f... Lus10002630 37.6 0.5643
AT5G63920 TOP3A, AtTOP3al... topoisomerase 3alpha (.1) Lus10006779 39.5 0.5627

Lus10035124 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.