Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G29970 111 / 5e-34 B12D protein (.1) AT3G48140 88 / 1e-24 B12D protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004241 [exp] 99 / 4e-29 AT3G48140 132 / 4e-42 B12D protein (.1) Lus10042151 [exp] 99 / 4e-29 AT3G48140 132 / 4e-42 B12D protein (.1) Lus10036977 [exp] 99 / 1e-28 AT3G48140 132 / 9e-42 B12D protein (.1) Lus10015825 [exp] 96 / 1e-27 AT3G48140 150 / 3e-49 B12D protein (.1) Lus10031971 [exp] 64 / 5e-14 AT5G60335 152 / 5e-47 Thioesterase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G098800 [exp] 116 / 6e-36 AT3G29970 131 / 9e-42 B12D protein (.1) Potri.004G117300 [exp] 107 / 2e-32 AT3G29970 126 / 9e-40 B12D protein (.1) Potri.012G074900 [exp] 105 / 2e-31 AT3G48140 137 / 8e-44 B12D protein (.1) Potri.008G179401 [exp] 103 / 8e-31 AT3G48140 137 / 8e-44 B12D protein (.1) Potri.010G055300 [exp] 103 / 6e-30 AT3G48140 132 / 8e-41 B12D protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06522 [flax] [poplar] B12D NADH-ubiquinone reductase complex 1 MLRQ subunit
Representative CDS sequence Show only first row Show all	>Lus10035132 pacid=23162511 polypeptide=Lus10035132 locus=Lus10035132.g ID=Lus10035132.BGIv1.0 annot-version=v1.0 ATGCAGGTTTACCCTCTGCTAGTGCCAATGGGATTTGTGTTGACCTTGGTGGGGTTTCAGCTTAGCAGAAACGTTATTCAGAACCCTGATGTTAGAATCA ACAAGAATAACAGGAAGCAAGGGGTGCTGGAGAACTACGAAGAAGGGGAGAAGTACGCAGAGCATGGGCTGCGCAAGTTCCTACGTACTCGCACGCCACA AGTCATGCCCACTCTTAATTCCTTCTTTTCCTCTGATCACAAATAA
AA sequence Show only first row Show all	>Lus10035132 pacid=23162511 polypeptide=Lus10035132 locus=Lus10035132.g ID=Lus10035132.BGIv1.0 annot-version=v1.0 MQVYPLLVPMGFVLTLVGFQLSRNVIQNPDVRINKNNRKQGVLENYEEGEKYAEHGLRKFLRTRTPQVMPTLNSFFSSDHK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G29970			B12D protein (.1)		Lus10035132 [exp]	0	1
AT3G11480		BSMT1, ATBSMT1	S-adenosyl-L-methionine-depend...		Lus10032299 [exp]	2.2	0.9461
					Lus10002237 [exp]	3.2	0.9363
AT2G27410	B3		Domain of unknown function (DU...		Lus10035394 [exp]	3.5	0.8900
					Lus10010306 [exp]	3.5	0.9320
AT1G66120			AMP-dependent synthetase and l...		Lus10031366 [exp]	4.0	0.9298
AT1G64870			unknown protein		Lus10041678 [exp]	6.0	0.9285
AT3G18150			RNI-like superfamily protein (...		Lus10042331 [exp]	6.8	0.8367
AT1G14550			Peroxidase superfamily protein...		Lus10009898 [exp]	7.4	0.9297
AT1G68630			PLAC8 family protein (.1)		Lus10009036 [exp]	7.9	0.9151
AT5G62000	ARF	ORE14, HSS, ARF...	ORESARA 14, HLS1 SUPPRESSOR, A...		Lus10040906 [exp]	8.3	0.8688

Compare expression of checked genes

Lus10035132 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.