Lus10035133 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G09990 259 / 3e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1)
AT5G18380 258 / 5e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1.2.3)
AT3G04230 243 / 3e-84 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031970 303 / 2e-107 AT2G09990 258 / 4e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Lus10034378 291 / 8e-103 AT5G18380 261 / 4e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1.2.3)
Lus10038012 290 / 1e-102 AT2G09990 258 / 5e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Lus10009252 290 / 1e-102 AT2G09990 258 / 5e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Lus10012599 289 / 5e-102 AT5G18380 261 / 4e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G304700 274 / 3e-96 AT2G09990 267 / 9e-94 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Potri.008G150000 272 / 2e-95 AT2G09990 262 / 1e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Potri.010G091000 271 / 4e-95 AT2G09990 260 / 7e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0329 S5 PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Representative CDS sequence
>Lus10035133 pacid=23162536 polypeptide=Lus10035133 locus=Lus10035133.g ID=Lus10035133.BGIv1.0 annot-version=v1.0
ATGGCGGCAACTGCTGCGCCTTCCCCAGTAGAGTCCGTCCAATGCTTCGGCCGCAAGAAGACGGCGGTGGCCGTCACCCACTGCAAGCGCGGCAGGGGAC
TCATCAAGCTCAACGGAACTCCGATCGAGCTCATCGAACCTGAGATCCTCCGCTTCAAGGCCGTTGAGCCCATCCTCCTCCTCGGACGTCAGCGTTTCAG
CGGTGTCGACATGCGCATCCGCGTGAAGGGAGGCGGTCACACTTCCCAGATCTACGCCATCCGTCAGAGCATCGCCAAGGCACTCGTCGCTTTCTACCAG
AAGTTTGTGGATGAGCAGAGCAAGAAGGAAATCAAGGACCTCTTGATCAGGTATGACAGGACTTTGCTGGTTGCTGATCCCAGGCGCTGCGAGCCGAAGA
AGTTTGGTGGACGTGGTGCCCGCTCCAGATTCCAGAAGAGTTACCGTTGA
AA sequence
>Lus10035133 pacid=23162536 polypeptide=Lus10035133 locus=Lus10035133.g ID=Lus10035133.BGIv1.0 annot-version=v1.0
MAATAAPSPVESVQCFGRKKTAVAVTHCKRGRGLIKLNGTPIELIEPEILRFKAVEPILLLGRQRFSGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQ
KFVDEQSKKEIKDLLIRYDRTLLVADPRRCEPKKFGGRGARSRFQKSYR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G09990 Ribosomal protein S5 domain 2-... Lus10035133 0 1
AT1G33140 PGY2 PIGGYBACK2, Ribosomal protein ... Lus10015588 4.7 0.9581
AT5G09510 Ribosomal protein S19 family p... Lus10033856 5.5 0.9526
AT4G15000 Ribosomal L27e protein family ... Lus10003814 5.5 0.9443
AT2G42740 RPL16A ribosomal protein large subuni... Lus10017648 5.7 0.9543
AT1G09640 Translation elongation factor ... Lus10002536 7.9 0.9492
AT1G61580 RPL3B, ARP2 ARABIDOPSIS RIBOSOMAL PROTEIN ... Lus10035786 10.8 0.9499
AT2G41840 Ribosomal protein S5 family pr... Lus10030130 12.6 0.9497
AT4G16720 Ribosomal protein L23/L15e fam... Lus10004743 16.6 0.9493
AT5G35530 Ribosomal protein S3 family pr... Lus10030503 17.0 0.9477
AT4G00100 PFL2, ATRPS13A POINTED FIRST LEAF 2, ribosoma... Lus10027192 21.4 0.9379

Lus10035133 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.