Lus10035139 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G16676 42 / 7e-05 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014248 74 / 3e-16 ND /
Lus10020135 74 / 4e-16 ND /
Lus10033213 57 / 2e-09 AT1G57720 600 / 0.0 Translation elongation factor EF1B, gamma chain (.1.2)
Lus10019378 47 / 9e-07 ND /
Lus10038707 47 / 2e-06 ND 42 / 4e-04
Lus10016642 41 / 0.0001 ND 38 / 8e-04
Lus10010788 39 / 0.0009 AT5G36228 42 / 1e-04 nucleic acid binding;zinc ion binding (.1)
Lus10022598 0 / 1 ND 36 / 0.006
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10035139 pacid=23162386 polypeptide=Lus10035139 locus=Lus10035139.g ID=Lus10035139.BGIv1.0 annot-version=v1.0
ATGAAGCTTTGGGTGCGTCTCGAGCGAGTGTCGGATCATCTGGGTACGCCGACCTTCGCCTCCGGTCTCTTGGGTCTTCTTGGTGAGGTCATCGATGTGG
GCCTCTACTCCTCTGCTGAGGAATCTGGCTATTTCTTACGGGGAGTTGTCCGCTCTGATGTTCGGGATTCCTTTGCTGGTCGTTGCCGTGCACGATCTGA
GGAGGGTACGGATTTTTGGGTGCGCCTTCGATGTGAGGGACTCCCGGTGATTTGTTTCCATTGTGGCGCTTTAGGCCACCATTTCAATCAGTGTCCGGTG
GAAGGGCATCATCCGATTGATCTTGAAAACCGTGGTTCCTGGATGAGTTTTCCGACGGGATCCTACAAGAAAGTGAACCCTTTCACTCTGCAATGTGAAT
CGAGGACTGCGACGGTGAACTCGCTGCCTAGTCTCGCTCCTAAGCCTCATGGGGCTGGTGCCTCCGCCACGTCTCGATGTCGCAAGCGACAGAGCTGGCT
GGCGCACGGGGATCTACCGTCTTCCTCGCGTCTAGTGCCCGCCGTCGAGTAG
AA sequence
>Lus10035139 pacid=23162386 polypeptide=Lus10035139 locus=Lus10035139.g ID=Lus10035139.BGIv1.0 annot-version=v1.0
MKLWVRLERVSDHLGTPTFASGLLGLLGEVIDVGLYSSAEESGYFLRGVVRSDVRDSFAGRCRARSEEGTDFWVRLRCEGLPVICFHCGALGHHFNQCPV
EGHHPIDLENRGSWMSFPTGSYKKVNPFTLQCESRTATVNSLPSLAPKPHGAGASATSRCRKRQSWLAHGDLPSSSRLVPAVE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G16676 unknown protein Lus10035139 0 1
AT1G67230 CRWN1, LINC1 CROWDED NUCLEI 1, little nucle... Lus10003075 3.5 0.8397
AT1G79020 Enhancer of polycomb-like tran... Lus10034778 3.7 0.8610
AT4G15900 PRL1 pleiotropic regulatory locus 1... Lus10037500 7.1 0.8252
AT5G12410 THUMP domain-containing protei... Lus10005018 10.6 0.8247
AT4G36650 ATPBRP plant-specific TFIIB-related p... Lus10024022 12.8 0.7956
AT5G05940 ATROPGEF5, ROPG... ROP guanine nucleotide exchang... Lus10000399 13.0 0.7679
AT3G18035 HON4 winged-helix DNA-binding trans... Lus10024594 13.0 0.7898
AT3G27260 GTE8 global transcription factor gr... Lus10014609 14.0 0.8162
AT3G13670 Protein kinase family protein ... Lus10042455 19.4 0.7868
AT2G34670 Protein of unknown function (D... Lus10036155 20.7 0.7957

Lus10035139 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.