Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G14610 193 / 2e-59 DEAD box RNA helicase family protein (.1.2) AT3G01540 185 / 1e-56 ATDRH1, DRH1 ARABIDOPSIS THALIANA DEAD BOX RNA HELICASE 1, DEAD box RNA helicase 1 (.1.2.3.4) AT3G06480 164 / 5e-48 DEAD box RNA helicase family protein (.1) AT5G63120 137 / 4e-39 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) AT1G55150 134 / 3e-38 DEA(D/H)-box RNA helicase family protein (.1) AT3G58510 108 / 2e-28 DEA(D/H)-box RNA helicase family protein (.1), DEA(D/H)-box RNA helicase family protein (.2), DEA(D/H)-box RNA helicase family protein (.3) AT1G31970 107 / 2e-28 STRS1 STRESS RESPONSE SUPPRESSOR 1, DEA(D/H)-box RNA helicase family protein (.1) AT1G20920 104 / 3e-27 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) AT3G58570 104 / 4e-27 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT2G42520 103 / 1e-26 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014553 [exp] 218 / 4e-68 AT5G14610 833 / 0.0 DEAD box RNA helicase family protein (.1.2) Lus10032133 [exp] 213 / 9e-67 AT5G14610 850 / 0.0 DEAD box RNA helicase family protein (.1.2) Lus10032135 [exp] 213 / 1e-66 AT5G14610 849 / 0.0 DEAD box RNA helicase family protein (.1.2) Lus10009474 [exp] 173 / 4e-51 AT3G06480 744 / 0.0 DEAD box RNA helicase family protein (.1) Lus10001272 [exp] 172 / 6e-51 AT5G14610 665 / 0.0 DEAD box RNA helicase family protein (.1.2) Lus10037646 [exp] 134 / 3e-38 AT1G55150 843 / 0.0 DEA(D/H)-box RNA helicase family protein (.1) Lus10015627 [exp] 134 / 5e-38 AT1G55150 845 / 0.0 DEA(D/H)-box RNA helicase family protein (.1) Lus10019484 [exp] 134 / 1e-37 AT5G63120 757 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) Lus10043334 [exp] 130 / 2e-36 AT5G63120 752 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G347100 [exp] 194 / 4e-59 AT5G14610 823 / 0.0 DEAD box RNA helicase family protein (.1.2) Potri.017G071400 [exp] 191 / 4e-58 AT5G14610 792 / 0.0 DEAD box RNA helicase family protein (.1.2) Potri.010G152400 [exp] 171 / 1e-50 AT3G06480 801 / 0.0 DEAD box RNA helicase family protein (.1) Potri.003G038300 [exp] 135 / 2e-38 AT1G55150 790 / 0.0 DEA(D/H)-box RNA helicase family protein (.1) Potri.015G083000 [exp] 134 / 8e-38 AT5G63120 707 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) Potri.012G084600 [exp] 125 / 2e-34 AT5G63120 704 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) Potri.005G257400 [exp] 114 / 2e-30 AT1G20920 1253 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) Potri.002G003600 [exp] 111 / 2e-29 AT1G20920 1201 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) Potri.003G098800 [exp] 108 / 2e-28 AT1G31970 726 / 0.0 STRESS RESPONSE SUPPRESSOR 1, DEA(D/H)-box RNA helicase family protein (.1) Potri.001G007900 [exp] 107 / 4e-28 AT2G42520 807 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00271 [flax] [poplar] Helicase_C Helicase conserved C-terminal domain
Representative CDS sequence Show only first row Show all	>Lus10035149 pacid=23162502 polypeptide=Lus10035149 locus=Lus10035149.g ID=Lus10035149.BGIv1.0 annot-version=v1.0 ATGTGCGACATACTTGCTCGTAACCTCATCCGGTTTGGAGCTGCTGCTATTCATGGAGACAAGTCACAGAGTGAGAGGGATCAAGTTTTGAGTCAGTTTC GGTCTGGGCGGGCTCCTCTGCTAGTAGCTACTGATGTTGCCGCCCGTGGTTTGGATGTAAAGGACATAAGGGTCGTAGTCAACTATGACTTCCCTAATGG CGTGGAGGATTACGTTCATAGGATTGGCAGAACTGGAAGAGCCGGTGCCACTGGTGTAGCTTATACATTCTTCGGAGAGCAGGATGCCAAACAAGCTACA GAGCTCGTTAAACTCTTAGAGGGTGCAAGCCAGAAGTTTCCTCCTGAAATTCGCGACATGGCTTCTTGA
AA sequence Show only first row Show all	>Lus10035149 pacid=23162502 polypeptide=Lus10035149 locus=Lus10035149.g ID=Lus10035149.BGIv1.0 annot-version=v1.0 MCDILARNLIRFGAAAIHGDKSQSERDQVLSQFRSGRAPLLVATDVAARGLDVKDIRVVVNYDFPNGVEDYVHRIGRTGRAGATGVAYTFFGEQDAKQAT ELVKLLEGASQKFPPEIRDMAS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G14610			DEAD box RNA helicase family p...		Lus10035149 [exp]	0	1
AT2G26695			Ran BP2/NZF zinc finger-like s...		Lus10033023 [exp]	1.0	0.9376
AT5G20990		B73, CNX1, SIR4...	SIRTINOL 4, CO-FACTOR FOR NITR...		Lus10000717 [exp]	1.4	0.8813
AT1G18060			unknown protein		Lus10012667 [exp]	2.4	0.8300
AT2G35210		RPA, AGD10, MEE...	MATERNAL EFFECT EMBRYO ARREST ...		Lus10000902 [exp]	3.2	0.8353
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10035637 [exp]	3.5	0.8741
AT5G25610		ATRD22, RD22	RESPONSIVE TO DESSICATION 22, ...		Lus10006555 [exp]	4.5	0.8476
AT1G47890		AtRLP7	receptor like protein 7 (.1)		Lus10004309 [exp]	7.0	0.8216
					Lus10008005 [exp]	7.4	0.7720
					Lus10007473 [exp]	10.6	0.7504
AT5G06600		AtUBP12, UBP12	ubiquitin-specific protease 12...		Lus10027030 [exp]	12.0	0.7925

Compare expression of checked genes

Lus10035149 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.