Lus10035156 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G26782 200 / 1e-60 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G13770 114 / 3e-29 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G01580 108 / 1e-27 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G55740 108 / 2e-27 CRR21 chlororespiratory reduction 21, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G33760 108 / 2e-27 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G11290 106 / 1e-26 CRR22 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G13230 105 / 2e-26 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G23330 103 / 9e-26 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G34400 103 / 1e-25 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT4G21300 103 / 1e-25 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031989 296 / 8e-97 AT3G26782 865 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10015225 110 / 8e-28 AT4G18750 990 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10010320 108 / 1e-27 AT2G34400 658 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10035788 106 / 2e-26 AT3G16610 636 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Lus10035164 105 / 3e-26 AT3G02010 962 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10031028 105 / 4e-26 AT4G19191 727 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10031994 105 / 4e-26 AT3G02010 957 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10025490 103 / 1e-25 AT2G33760 734 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10002552 100 / 1e-25 AT2G22410 299 / 2e-97 SLOW GROWTH 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G322100 199 / 1e-60 AT3G26782 897 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G043400 120 / 9e-32 AT2G33760 775 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.010G161800 119 / 2e-31 AT2G03380 786 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.011G052300 117 / 2e-30 AT2G33760 747 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G074000 114 / 3e-29 AT4G39952 892 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.003G088600 110 / 3e-28 AT1G31430 690 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.001G186500 110 / 5e-28 AT3G23330 717 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.006G211400 108 / 1e-27 AT3G11460 772 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.012G041200 107 / 4e-27 AT5G16860 1083 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.003G006800 106 / 1e-26 AT3G16610 687 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10035156 pacid=23162443 polypeptide=Lus10035156 locus=Lus10035156.g ID=Lus10035156.BGIv1.0 annot-version=v1.0
ATGGAAGTAGTGATGAGGAAGAGGAGATGGCCGTCTCGTCTTTCTGTATTGGGGATGACTGAGGGTCTACATGGCTTTATTGTCAAGTTGGGATTCGATG
ATGAAGTGAGAGTTGCTAATACTATGCTTACTGCATATGCCAAGGGTGGTGCTGTGGGAATGTCTAGAAAGGTGTTCAACGAAATTAGTGAGAGAGACTC
AGTATCTTGGAATTCTATTATGGCGATGTATGCTCAAAATGGCTTATCCGGGGAGGCATTTGAAGTGTTCAATGCAATGGTTAAAGGTGGCGTATCGGAA
TACAATGCAGTGACATTATCTACTCTATTGTTAGCTTCTGCTCATTCTGGGTCTTTGCGAGCAGGCAAGTGTATTCATGATCAGGCTATAAAGATGGGAA
TCCTGGATAATGTAGTGGTGGGAACCTCTGTCATTGATATGTACTGCAAATGTGGGAAAGTTCAAATGGCTAGAAAGTCATTTGATGGTATGAAGGAGAA
AACTGTAAGATCTTGGACAGCTATGATTAGCGGTTATGGTATGCAGGTTTCGCAATGGAAGCCTTGGATGTTTTCTATGAGATGA
AA sequence
>Lus10035156 pacid=23162443 polypeptide=Lus10035156 locus=Lus10035156.g ID=Lus10035156.BGIv1.0 annot-version=v1.0
MEVVMRKRRWPSRLSVLGMTEGLHGFIVKLGFDDEVRVANTMLTAYAKGGAVGMSRKVFNEISERDSVSWNSIMAMYAQNGLSGEAFEVFNAMVKGGVSE
YNAVTLSTLLLASAHSGSLRAGKCIHDQAIKMGILDNVVVGTSVIDMYCKCGKVQMARKSFDGMKEKTVRSWTAMISGYGMQVSQWKPWMFSMR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G26782 Tetratricopeptide repeat (TPR)... Lus10035156 0 1
AT2G46050 Pentatricopeptide repeat (PPR-... Lus10036375 12.6 0.8132
AT5G64580 EMB3144 EMBRYO DEFECTIVE 3144, AAA-typ... Lus10033496 23.0 0.8089
AT3G15140 Polynucleotidyl transferase, r... Lus10009194 49.2 0.8023
AT3G14620 CYP72A8 "cytochrome P450, family 72, s... Lus10026681 50.0 0.7901
AT5G40410 Tetratricopeptide repeat (TPR)... Lus10005637 57.1 0.7635
AT4G35130 Tetratricopeptide repeat (TPR)... Lus10035619 64.9 0.7669
AT3G49740 Tetratricopeptide repeat (TPR)... Lus10011563 69.0 0.7536
AT5G67570 EMB246, DG1, EM... EMBRYO DEFECTIVE 246, embryo d... Lus10012091 86.1 0.7748
AT5G22410 RHS18 root hair specific 18 (.1) Lus10043010 88.0 0.7704
AT1G12950 RSH2 root hair specific 2 (.1) Lus10036853 92.6 0.7142

Lus10035156 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.