Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G26782 219 / 8e-69 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G30700 179 / 5e-53 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G57430 177 / 3e-52 OTP84 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G08070 174 / 2e-51 EMB3102, OTP82 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G27610 173 / 6e-51 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G37380 170 / 1e-50 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G02750 171 / 2e-50 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G23330 171 / 2e-50 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G41080 166 / 2e-49 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G22070 168 / 3e-49 pentatricopeptide (PPR) repeat-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031989 [exp] 300 / 3e-99 AT3G26782 865 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10028837 [exp] 187 / 2e-58 AT1G11290 650 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10017446 [exp] 185 / 3e-55 AT1G11290 1152 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10040577 [exp] 176 / 9e-55 AT1G25360 577 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10038400 [exp] 178 / 1e-52 AT3G57430 1097 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10001220 [exp] 178 / 2e-52 AT3G57430 1110 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10015414 [exp] 177 / 3e-52 AT3G57430 629 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10013991 [exp] 177 / 4e-52 AT3G57430 632 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10000706 [exp] 174 / 3e-51 AT3G12770 878 / 0.0 mitochondrial editing factor 22 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G322100 [exp] 250 / 2e-80 AT3G26782 897 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.001G075800 [exp] 194 / 1e-58 AT3G57430 1189 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.018G040100 [exp] 182 / 1e-54 AT1G08070 974 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.001G354400 [exp] 179 / 1e-53 AT5G46460 863 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.017G091600 [exp] 177 / 8e-53 AT4G37170 924 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.016G075000 [exp] 175 / 3e-52 AT2G41080 755 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.003G191000 [exp] 176 / 4e-52 AT1G11290 1178 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G005700 [exp] 175 / 5e-52 AT3G49142 912 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.002G220300 [exp] 175 / 5e-52 AT1G11290 559 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.002G027800 [exp] 176 / 6e-52 AT1G25360 1047 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10035157 pacid=23162592 polypeptide=Lus10035157 locus=Lus10035157.g ID=Lus10035157.BGIv1.0 annot-version=v1.0 ATGAGAGCGCTCATGAAAGATAGTGGGCTATTCAAGACGCCTGGTTTCAGTCTAACTGAACTCAAGGGCGACGTGCATGTTTTCCTGGTTGGAGATAAAG ACCATCCTCAACACAAGAAGATTTATCAGTATTTGGAAAACCTTGATGTAAGGCTGCAGCATGCTGGCTATGTACCTGATATGGCTTCTGTCCCTCATGA TGTTGACGAGGAAGAGAAGGGAATAAATTTGCGAGGTCATAGTGAGAAATTAGCGGTTGCTTTTGGGATCATTAACTCAGTTCCTGGAGCAACAATTCAT GTCATGAAGAATCTTCGGGTCTGTGGTGATTGCCACACTGTGATTAAGCTGATATCCAAGATTGAAAACCGGGAAATTACCGTGAGAGATTCAAAGCGGT TTCATCACTTCAAGGATGGTGTTTGTTCATGTGGAGATTATTGGTAA
AA sequence Show only first row Show all	>Lus10035157 pacid=23162592 polypeptide=Lus10035157 locus=Lus10035157.g ID=Lus10035157.BGIv1.0 annot-version=v1.0 MRALMKDSGLFKTPGFSLTELKGDVHVFLVGDKDHPQHKKIYQYLENLDVRLQHAGYVPDMASVPHDVDEEEKGINLRGHSEKLAVAFGIINSVPGATIH VMKNLRVCGDCHTVIKLISKIENREITVRDSKRFHHFKDGVCSCGDYW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G26782			Tetratricopeptide repeat (TPR)...		Lus10035157 [exp]	0	1
AT1G79560		EMB36, EMB156, ...	EMBRYO DEFECTIVE 36, EMBRYO DE...		Lus10031745 [exp]	16.8	0.7636
AT4G00110		GAE3	UDP-D-glucuronate 4-epimerase ...		Lus10031127 [exp]	30.4	0.7484
AT3G50420			Pentatricopeptide repeat (PPR)...		Lus10016772 [exp]	40.5	0.7181
AT5G13700		ATPAO1, APAO	polyamine oxidase 1 (.1)		Lus10019725 [exp]	41.6	0.6552
AT5G64050		ATERS, ERS, OVA...	OVULE ABORTION 3, glutamate tR...		Lus10012512 [exp]	46.0	0.7270
AT1G79050			recA DNA recombination family ...		Lus10026204 [exp]	60.6	0.7125
AT2G23180		CYP96A1	"cytochrome P450, family 96, s...		Lus10002527 [exp]	60.8	0.7031
AT4G37920			unknown protein		Lus10029560 [exp]	71.1	0.6959
AT5G59500			protein C-terminal S-isoprenyl...		Lus10004974 [exp]	72.1	0.7099
AT3G49740			Tetratricopeptide repeat (TPR)...		Lus10011563 [exp]	78.7	0.7049

Compare expression of checked genes

Lus10035157 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.