Lus10035166 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G14030 216 / 5e-72 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031996 282 / 6e-98 AT5G14030 263 / 1e-90 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4)
Lus10012565 252 / 3e-86 AT5G14030 254 / 5e-87 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4)
Lus10041525 238 / 8e-79 AT5G14030 216 / 8e-70 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G323400 227 / 4e-76 AT5G14030 215 / 2e-71 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4)
Potri.017G061900 226 / 1e-75 AT5G14030 210 / 6e-69 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0159 E-set PF05753 TRAP_beta Translocon-associated protein beta (TRAPB)
Representative CDS sequence
>Lus10035166 pacid=23162349 polypeptide=Lus10035166 locus=Lus10035166.g ID=Lus10035166.BGIv1.0 annot-version=v1.0
ATGGCGATCCCAGTGCTTAGCTCTCTAGTTTCTGTGCTGCTCATTCTTCTCTTCGTCTCCTCGACGACCCTAGCTGCCACTGATGTCCCTTTCATCGTAG
CTCACAAGAAGGCCACTCTCAACAGGCTCAAATCCGGCGCTGAGCGCGTCTCTGTCTCCATCGATATCTACAACCAAGGATCCTCGACAGCTTATGATGT
GAGTCTTGTCGATGATCACTGGCCTCAAGATTTGTTTGATGTTGTGAGCGGTAACTTTTCCCAATCATGGGAACGTCTAGACTCTGGTGGTTTGTTGTCG
CATTCTTTTGAACTCGAGGGAAAAGTGAAGGGTGTGTTCTACAGTGCCCCGGCTGTTATTACATTCCGCATCCCTACCAAGGCTGTTTTACAGGAGGCAT
TCTCAACTCCCATAATGCCCCTCGATATTCTGGCGGACAGACCTACTGAGAATACGCTTGATTTGAGGTTGTTGGCCAAGTATGGATCTTTGGTATCGGT
CATTTCAATCGTGGTTCTGTTTGTGTACCTTGTGAGCACTCCGTCGAAATCTAGTGGTCCTAAAGGGAGCAAGAAGAAGCGTTAA
AA sequence
>Lus10035166 pacid=23162349 polypeptide=Lus10035166 locus=Lus10035166.g ID=Lus10035166.BGIv1.0 annot-version=v1.0
MAIPVLSSLVSVLLILLFVSSTTLAATDVPFIVAHKKATLNRLKSGAERVSVSIDIYNQGSSTAYDVSLVDDHWPQDLFDVVSGNFSQSWERLDSGGLLS
HSFELEGKVKGVFYSAPAVITFRIPTKAVLQEAFSTPIMPLDILADRPTENTLDLRLLAKYGSLVSVISIVVLFVYLVSTPSKSSGPKGSKKKR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G14030 translocon-associated protein ... Lus10035166 0 1
AT4G09900 ATMES12 ARABIDOPSIS THALIANA METHYL ES... Lus10003511 12.5 0.7733
AT5G56580 ANQ1, ATMKK6 ARABIDOPSIS THALIANA MAP KINAS... Lus10034986 13.3 0.7705
AT1G20050 HYD1 HYDRA1, C-8,7 sterol isomerase... Lus10032965 16.8 0.7560
AT3G03320 RNA-binding ASCH domain protei... Lus10020510 35.7 0.6702
AT5G18900 2-oxoglutarate (2OG) and Fe(II... Lus10012014 44.7 0.7308
AT3G44010 Ribosomal protein S14p/S29e fa... Lus10039155 54.1 0.7288
AT5G65980 Auxin efflux carrier family pr... Lus10001303 57.5 0.7401
AT2G19730 Ribosomal L28e protein family ... Lus10006869 74.8 0.7156
AT1G64520 RPN12A regulatory particle non-ATPase... Lus10023053 82.0 0.6598
Lus10004065 91.2 0.7101

Lus10035166 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.