Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G27435 102 / 4e-30 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032003 [exp] 129 / 6e-41 AT1G27435 107 / 5e-32 unknown protein Lus10012558 [exp] 108 / 1e-32 AT1G27435 106 / 5e-32 unknown protein Lus10041533 [exp] 107 / 3e-32 AT1G27435 104 / 4e-31 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G325000 [exp] 100 / 2e-29 AT1G27435 103 / 1e-30 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10035173 pacid=23162404 polypeptide=Lus10035173 locus=Lus10035173.g ID=Lus10035173.BGIv1.0 annot-version=v1.0 ATGGCTGGAGTAGGAGGAGCGTTTTGGGCAACGAGAGTAATGGAGATAGTGAAGAAGCATGACTCTGGAGGACTCGTTTGGAAAAGAATCAAACTCACCC CTTCTCGTAAAGCCAACGCCAAGAAGCGCCTCCAACGTGTCTGGCAGAATGAAGCTGTCTTGAGGGCCTGCGCCGAAGAACCATCTTCAACAACACCCAC AAATGAGACTGGTGGCACTGGAGAAGTAGATGGTCCCAACAACTTGAATACATCCAGTTAA
AA sequence Show only first row Show all	>Lus10035173 pacid=23162404 polypeptide=Lus10035173 locus=Lus10035173.g ID=Lus10035173.BGIv1.0 annot-version=v1.0 MAGVGGAFWATRVMEIVKKHDSGGLVWKRIKLTPSRKANAKKRLQRVWQNEAVLRACAEEPSSTTPTNETGGTGEVDGPNNLNTSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G27435			unknown protein		Lus10035173 [exp]	0	1
AT2G28720			Histone superfamily protein (....		Lus10028826 [exp]	2.4	0.9034
AT1G20580			Small nuclear ribonucleoprotei...		Lus10016013 [exp]	5.5	0.8855
AT3G18880			Nucleic acid-binding, OB-fold-...		Lus10017467 [exp]	6.3	0.8775
AT2G40060		CLC2	clathrin light chain 2, Clathr...		Lus10030401 [exp]	6.6	0.8774
AT1G19990			unknown protein		Lus10033141 [exp]	7.2	0.9021
AT1G76860			Small nuclear ribonucleoprotei...		Lus10040487 [exp]	11.0	0.8764
AT2G15270			unknown protein		Lus10027866 [exp]	12.9	0.8479
AT5G02820		BIN5, RHL2	ROOT HAIRLESS 2, BRASSINOSTERO...		Lus10015052 [exp]	13.0	0.8793
AT5G52860		ABCG8	ATP-binding cassette G8, ABC-2...		Lus10027545 [exp]	13.6	0.8940
AT1G32580			plastid developmental protein ...		Lus10023744 [exp]	13.7	0.8780

Compare expression of checked genes

Lus10035173 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.