Lus10035183 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G14070 146 / 4e-46 ROXY2 Thioredoxin superfamily protein (.1)
AT3G02000 127 / 9e-39 ROXY1 Thioredoxin superfamily protein (.1)
AT4G15690 112 / 4e-33 Thioredoxin superfamily protein (.1)
AT4G15700 111 / 8e-33 Thioredoxin superfamily protein (.1)
AT4G15680 109 / 4e-32 Thioredoxin superfamily protein (.1)
AT4G15660 109 / 4e-32 Thioredoxin superfamily protein (.1)
AT4G15670 109 / 5e-32 Thioredoxin superfamily protein (.1)
AT3G21460 108 / 1e-31 Glutaredoxin family protein (.1)
AT3G62950 108 / 1e-31 Thioredoxin superfamily protein (.1)
AT5G18600 104 / 6e-30 Thioredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011333 146 / 1e-45 AT5G14070 151 / 1e-47 Thioredoxin superfamily protein (.1)
Lus10041538 145 / 2e-45 AT5G14070 134 / 3e-41 Thioredoxin superfamily protein (.1)
Lus10033965 114 / 9e-34 AT5G18600 148 / 5e-48 Thioredoxin superfamily protein (.1)
Lus10023295 115 / 1e-33 AT5G14070 123 / 5e-37 Thioredoxin superfamily protein (.1)
Lus10013962 113 / 2e-33 AT1G28480 135 / 3e-42 Thioredoxin superfamily protein (.1)
Lus10002887 112 / 6e-33 AT4G15690 149 / 3e-48 Thioredoxin superfamily protein (.1)
Lus10012815 111 / 2e-32 AT3G21460 171 / 3e-57 Glutaredoxin family protein (.1)
Lus10038514 111 / 4e-32 AT5G14070 122 / 2e-36 Thioredoxin superfamily protein (.1)
Lus10040899 104 / 4e-30 AT2G30540 140 / 5e-45 Thioredoxin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G325800 171 / 5e-56 AT3G02000 155 / 6e-50 Thioredoxin superfamily protein (.1)
Potri.001G060600 166 / 5e-54 AT5G14070 147 / 1e-46 Thioredoxin superfamily protein (.1)
Potri.003G167000 162 / 2e-52 AT5G14070 150 / 9e-48 Thioredoxin superfamily protein (.1)
Potri.008G214500 119 / 5e-36 AT3G21460 177 / 2e-59 Glutaredoxin family protein (.1)
Potri.008G214600 106 / 7e-31 AT5G18600 159 / 2e-52 Thioredoxin superfamily protein (.1)
Potri.010G021800 105 / 2e-30 AT5G18600 163 / 5e-54 Thioredoxin superfamily protein (.1)
Potri.008G214800 104 / 5e-30 AT5G18600 157 / 2e-51 Thioredoxin superfamily protein (.1)
Potri.014G134000 102 / 5e-29 AT3G62930 158 / 8e-52 Thioredoxin superfamily protein (.1)
Potri.004G049800 102 / 1e-28 AT1G28480 94 / 2e-25 Thioredoxin superfamily protein (.1)
Potri.002G208400 100 / 2e-28 AT2G30540 160 / 8e-53 Thioredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00462 Glutaredoxin Glutaredoxin
Representative CDS sequence
>Lus10035183 pacid=23162384 polypeptide=Lus10035183 locus=Lus10035183.g ID=Lus10035183.BGIv1.0 annot-version=v1.0
ATGTACCAAACAGATTCATCATGGAACTGCATTAGTTCAGCTGGAGGCAGAGGACCAAGACTCGGTGCAAGCGGTGGCGGCGGAGGGGACCGGGCGGCGG
CTCGCATACACCAGCTGGCGGCGGGGAACGCGGTGGTGATATTCAGCATAAGCAGCTGCTGCATGTGCCACGTCATCAAGCGGCTGTTCTCCGGCATGGG
AGTCAACCCGACGGTGTACGAGCTCGACGACGATCCCATTGCCGGAAAGGAGATAGAGATGGCTCTGATGCGACTGCTGGGAACTTCGTCGGCGGTGGTC
CCCGTCGTCTTCATCGGAGGTAAGCTGGTGGGAGCAATGGAAAGAGTGATGGCGTCTCACATTAACGGCACGCTGGTTCCGTTACTCAAAGAAGCCGGCG
CTCTCTGGCTCTAG
AA sequence
>Lus10035183 pacid=23162384 polypeptide=Lus10035183 locus=Lus10035183.g ID=Lus10035183.BGIv1.0 annot-version=v1.0
MYQTDSSWNCISSAGGRGPRLGASGGGGGDRAAARIHQLAAGNAVVIFSISSCCMCHVIKRLFSGMGVNPTVYELDDDPIAGKEIEMALMRLLGTSSAVV
PVVFIGGKLVGAMERVMASHINGTLVPLLKEAGALWL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G14070 ROXY2 Thioredoxin superfamily protei... Lus10035183 0 1
AT4G11080 3xHMG-box1 3xHigh Mobility Group-box1, HM... Lus10033951 4.0 0.9164
AT3G19184 B3 AP2/B3-like transcriptional fa... Lus10019870 11.4 0.9015
AT1G75250 MYB RSM3, ATRL6 RADIALIS-LIKE SANT/MYB 3, RAD-... Lus10002538 16.6 0.8784
AT2G20515 unknown protein Lus10022928 17.0 0.9021
AT1G14900 HMGA high mobility group A (.1) Lus10004056 19.5 0.8955
AT2G36400 GRF ATGRF3 growth-regulating factor 3 (.1... Lus10014381 20.2 0.8884
AT1G14900 HMGA high mobility group A (.1) Lus10002284 26.7 0.8938
AT1G80100 AHP6 histidine phosphotransfer prot... Lus10011487 28.1 0.7903
AT5G48480 Lactoylglutathione lyase / gly... Lus10009579 29.4 0.8717
AT5G02560 HTA12 histone H2A 12 (.1.2) Lus10040853 30.7 0.8943

Lus10035183 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.