Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G26980 178 / 3e-59 MUB4 membrane-anchored ubiquitin-fold protein 4 precursor (.1) AT4G24990 169 / 8e-56 ATGP4 Ubiquitin family protein (.1) AT1G77870 131 / 8e-41 MUB5 membrane-anchored ubiquitin-fold protein 5 precursor (.1) AT1G22050 130 / 2e-40 MUB6 membrane-anchored ubiquitin-fold protein 6 precursor (.1) AT5G15460 111 / 8e-33 MUB2 membrane-anchored ubiquitin-fold protein 2 (.1.2) AT3G01050 108 / 1e-31 MUB1 membrane-anchored ubiquitin-fold protein 1 precursor (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032014 [exp] 236 / 2e-82 AT3G26980 174 / 9e-58 membrane-anchored ubiquitin-fold protein 4 precursor (.1) Lus10012555 [exp] 228 / 5e-71 AT5G13990 608 / 0.0 exocyst subunit exo70 family protein C2 (.1) Lus10041539 [exp] 192 / 1e-64 AT3G26980 168 / 4e-55 membrane-anchored ubiquitin-fold protein 4 precursor (.1) Lus10013190 [exp] 120 / 3e-36 AT5G15460 150 / 8e-48 membrane-anchored ubiquitin-fold protein 2 (.1.2) Lus10030704 [exp] 119 / 3e-36 AT5G15460 150 / 2e-48 membrane-anchored ubiquitin-fold protein 2 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G325900 [exp] 197 / 8e-67 AT3G26980 169 / 7e-56 membrane-anchored ubiquitin-fold protein 4 precursor (.1) Potri.017G068100 [exp] 184 / 7e-62 AT3G26980 154 / 1e-49 membrane-anchored ubiquitin-fold protein 4 precursor (.1) Potri.012G103100 [exp] 166 / 1e-54 AT4G24990 207 / 5e-71 Ubiquitin family protein (.1) Potri.015G101200 [exp] 157 / 5e-51 AT4G24990 197 / 6e-67 Ubiquitin family protein (.1) Potri.004G124600 [exp] 129 / 4e-40 AT3G01050 155 / 2e-50 membrane-anchored ubiquitin-fold protein 1 precursor (.1) Potri.017G090700 [exp] 126 / 1e-38 AT3G01050 157 / 7e-51 membrane-anchored ubiquitin-fold protein 1 precursor (.1) Potri.002G091800 [exp] 101 / 5e-29 AT1G22050 124 / 5e-38 membrane-anchored ubiquitin-fold protein 6 precursor (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10035184 pacid=23162599 polypeptide=Lus10035184 locus=Lus10035184.g ID=Lus10035184.BGIv1.0 annot-version=v1.0 ATGCCGGAGGAGGATTTTTTGGAGGTTAGGTTCAGGTTGTATGATGCAACCGATATTGGTCCGTTTAGCTATTCTCCGGCGTCGACGGTTGCTGTTTTGA AAGAAAGGATTGTTGCCGAGTGGCCAAAAGATAAGAAAACTGCACCCAGGGGAGCAAATGACATCAAGCTGATAAATGCTGGAAAGATCTTGGAGAATAC CAAGACTGTTGGCCAGTGTAGGGCTCCTTTCGACACGCTGCCAAACAGTGTGATTACCATGCATGTTGTGGTTCAGCCATCTTTGGCGAAGGCAAAGACA GAGAAAAAGGTGGACGATGGTCCGAGAAAGACCCTGTGTTCGTGTACGATATTGTAA
AA sequence Show only first row Show all	>Lus10035184 pacid=23162599 polypeptide=Lus10035184 locus=Lus10035184.g ID=Lus10035184.BGIv1.0 annot-version=v1.0 MPEEDFLEVRFRLYDATDIGPFSYSPASTVAVLKERIVAEWPKDKKTAPRGANDIKLINAGKILENTKTVGQCRAPFDTLPNSVITMHVVVQPSLAKAKT EKKVDDGPRKTLCSCTIL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G26980		MUB4	membrane-anchored ubiquitin-fo...		Lus10035184 [exp]	0	1
AT3G19460			Reticulon family protein (.1.2...		Lus10019812 [exp]	1.0	0.9053
AT1G12400			Nucleotide excision repair, TF...		Lus10006998 [exp]	5.1	0.8844
AT5G05800			unknown protein		Lus10024329 [exp]	5.3	0.8666
AT5G09260		VPS20.2	vacuolar protein sorting-assoc...		Lus10037699 [exp]	5.5	0.8971
AT3G48140			B12D protein (.1)		Lus10042151 [exp]	6.6	0.9038
AT2G04900			unknown protein		Lus10001166 [exp]	9.8	0.8724
AT2G04520			Nucleic acid-binding, OB-fold-...		Lus10002264 [exp]	10.2	0.8813
AT4G14710		ATARD2	RmlC-like cupins superfamily p...		Lus10039375 [exp]	12.3	0.8875
					Lus10022600 [exp]	12.4	0.8619
AT1G50740			Transmembrane proteins 14C (.1...		Lus10008541 [exp]	13.0	0.8988

Compare expression of checked genes

Lus10035184 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.