Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G41050 159 / 2e-50 Pollen Ole e 1 allergen and extensin family protein (.1) AT3G26960 158 / 8e-50 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G13140 148 / 7e-45 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G45880 42 / 4e-05 Pollen Ole e 1 allergen and extensin family protein (.1) AT4G18596 41 / 9e-05 Pollen Ole e 1 allergen and extensin family protein (.1) AT1G78040 40 / 0.0001 Pollen Ole e 1 allergen and extensin family protein (.1.2) AT1G29140 39 / 0.0005 Pollen Ole e 1 allergen and extensin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032018 [exp] 298 / 6e-105 AT5G41050 162 / 2e-51 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10012553 [exp] 214 / 3e-72 AT5G41050 168 / 3e-54 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10041541 [exp] 208 / 3e-70 AT5G41050 169 / 2e-54 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10034365 [exp] 51 / 7e-08 AT5G15780 129 / 7e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10005086 [exp] 48 / 1e-06 AT5G15780 133 / 5e-35 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10017940 [exp] 45 / 4e-06 AT1G29140 117 / 8e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10013681 [exp] 44 / 1e-05 AT1G29140 117 / 6e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10018131 [exp] 41 / 0.0001 AT1G29140 118 / 5e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10001895 [exp] 40 / 0.0002 AT1G29140 157 / 2e-49 Pollen Ole e 1 allergen and extensin family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G326200 [exp] 206 / 6e-69 AT5G41050 158 / 9e-50 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.017G068400 [exp] 203 / 1e-67 AT5G41050 172 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G060500 [exp] 189 / 1e-60 AT5G13140 185 / 3e-57 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.003G167100 [exp] 166 / 1e-51 AT5G13140 180 / 2e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.004G114300 [exp] 56 / 2e-09 AT5G15780 178 / 5e-52 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.017G100600 [exp] 54 / 4e-09 AT5G15780 173 / 1e-49 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.011G111300 [exp] 40 / 0.0002 AT1G29140 148 / 4e-46 Pollen Ole e 1 allergen and extensin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0287 [flax] [poplar] Transthyretin PF01190 [flax] [poplar] Pollen_Ole_e_1 Pollen protein Ole e 1 like
Representative CDS sequence Show only first row Show all	>Lus10035187 pacid=23162391 polypeptide=Lus10035187 locus=Lus10035187.g ID=Lus10035187.BGIv1.0 annot-version=v1.0 ATGAATCATCATCCCATTACTTTTGTTTTGTTCCTCCTCTCATGTTTACTTGCCAAATCACTCTCCTTACCCACAAGAACTGCACAAATCAGAGTCATTG GTTTTGTTTACTGTGACATCTGCTCCAACAACAGCTTTTCCAGGCACAGCTATTTCATGCCAGGTTCAGAAGTAACAATAGACTGCAAGTTCAGAGCAAA TTCCCCCAAAACAATAGAGGAGATTGCATTCTCAGTGAACAGGACAACCAACAGGTACGGTGTGTACAAATTCGACATACCAGCTGTCGACGGGATCGAT TGTGCAGAAGACTCAGCCGCCATTGCAACGTCTTGTGAGGCGAGCTTGATCGGAACTTCGTCTAGATCGTGCAATGTTCCCGGATACAAATTCACATCGG AGCAGATAGCTGTAATTAAAGCAAGGAAACTCAATCTCTGTATCTACAGCCTCAATGCCTTGACTTTCAGACCCTCGAAACACGATGTCTCTTTGTGCGG GCATTAG
AA sequence Show only first row Show all	>Lus10035187 pacid=23162391 polypeptide=Lus10035187 locus=Lus10035187.g ID=Lus10035187.BGIv1.0 annot-version=v1.0 MNHHPITFVLFLLSCLLAKSLSLPTRTAQIRVIGFVYCDICSNNSFSRHSYFMPGSEVTIDCKFRANSPKTIEEIAFSVNRTTNRYGVYKFDIPAVDGID CAEDSAAIATSCEASLIGTSSRSCNVPGYKFTSEQIAVIKARKLNLCIYSLNALTFRPSKHDVSLCGH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G41050			Pollen Ole e 1 allergen and ex...		Lus10035187 [exp]	0	1
AT5G41050			Pollen Ole e 1 allergen and ex...		Lus10032018 [exp]	1.0	0.9528
AT2G21280		GC1, ATSULA	GIANT CHLOROPLAST 1, NAD(P)-bi...		Lus10042051 [exp]	2.4	0.9126
AT5G54290		CcdA	cytochrome c biogenesis protei...		Lus10038581 [exp]	3.3	0.8936
AT1G09310			Protein of unknown function, D...		Lus10010904 [exp]	3.5	0.9185
AT2G36970			UDP-Glycosyltransferase superf...		Lus10016128 [exp]	5.0	0.9081
AT1G08810	MYB	ATMYB60	myb domain protein 60 (.1.2)		Lus10020343 [exp]	5.5	0.9059
AT5G56850			unknown protein		Lus10032679 [exp]	7.5	0.8955
AT1G09310			Protein of unknown function, D...		Lus10031428 [exp]	13.7	0.9084
AT2G25737			Sulfite exporter TauE/SafE fam...		Lus10011683 [exp]	15.7	0.8573
AT1G72970		HTH, EDA17	HOTHEAD, embryo sac developmen...		Lus10037640 [exp]	21.2	0.8669

Compare expression of checked genes

Lus10035187 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.