Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032027 [exp] 219 / 5e-75 ND / Lus10008547 [exp] 144 / 5e-44 ND / Lus10034546 [exp] 113 / 2e-33 AT3G22060 43 / 1e-05 Receptor-like protein kinase-related family protein (.1) Lus10030780 [exp] 108 / 3e-31 ND 36 / 0.004 Lus10013255 [exp] 106 / 2e-30 ND / Lus10034545 [exp] 102 / 6e-29 ND / Lus10030777 [exp] 102 / 6e-29 AT5G48540 39 / 8e-04 receptor-like protein kinase-related family protein (.1) Lus10013254 [exp] 99 / 1e-27 ND / Lus10013256 [exp] 100 / 2e-27 AT3G21970 39 / 8e-04 Domain of unknown function (DUF26) (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10035197 pacid=23162356 polypeptide=Lus10035197 locus=Lus10035197.g ID=Lus10035197.BGIv1.0 annot-version=v1.0 ATGGCAATGACGATGCTGCTGCTTATATTAACATCATCGGTTACAGTGTCGGGGCAAAATTCTTGCGGCTCGAGGAGGCCGGCGGCAGTCGGGGTATGTA AAGACGACTACGCGAGTTGTGTAGCCAACGTGATCACGGTGTTAAGGGACAGGACGGCCTACACTAAAAATCAGAGGTTCGATACGGCTTACCCACTTAA CGGACCCTATGGCGGCGTTGTGGGTCAAGCGGCTTGCGTCGATGGATCTAGCTTTGCTGAATGCCAGAGAAGCCTTTCCGCCGCTAAAGAATGGCTCGAG CATAATTGCGGCGGTTCTTCCGCTGGCGGCACCTTCTCCGACAGGATTTGCTCCATGGCGTACGGCCAACTGTCGCGTTAA
AA sequence Show only first row Show all	>Lus10035197 pacid=23162356 polypeptide=Lus10035197 locus=Lus10035197.g ID=Lus10035197.BGIv1.0 annot-version=v1.0 MAMTMLLLILTSSVTVSGQNSCGSRRPAAVGVCKDDYASCVANVITVLRDRTAYTKNQRFDTAYPLNGPYGGVVGQAACVDGSSFAECQRSLSAAKEWLE HNCGGSSAGGTFSDRICSMAYGQLSR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10035197 [exp]	0	1
AT4G35640		ATSERAT3;2	serine acetyltransferase 3;2 (...		Lus10007424 [exp]	7.7	0.7057
AT1G55730		ATCAX5	cation exchanger 5 (.1.2)		Lus10009430 [exp]	8.8	0.7968
AT5G16940			carbon-sulfur lyases (.1.2)		Lus10000116 [exp]	15.0	0.6840
AT5G36930			Disease resistance protein (TI...		Lus10007810 [exp]	23.7	0.7383
AT3G52950			CBS / octicosapeptide/Phox/Bem...		Lus10035965 [exp]	26.5	0.7090
					Lus10034884 [exp]	33.0	0.6953
					Lus10040408 [exp]	37.2	0.6829
AT5G16940			carbon-sulfur lyases (.1.2)		Lus10018517 [exp]	42.4	0.6759
AT2G23180		CYP96A1	"cytochrome P450, family 96, s...		Lus10015307 [exp]	52.2	0.6953
AT5G01110			Tetratricopeptide repeat (TPR)...		Lus10028944 [exp]	68.6	0.6027

Compare expression of checked genes

Lus10035197 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.