Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G48660 74 / 2e-19 Protein of unknown function (DUF 3339) (.1) AT5G63500 72 / 1e-18 Protein of unknown function (DUF 3339) (.1) AT5G08391 69 / 1e-17 Protein of unknown function (DUF 3339) (.1) AT3G27030 66 / 2e-15 unknown protein AT5G40980 60 / 5e-14 Protein of unknown function (DUF 3339) (.1) AT3G27027 59 / 1e-13 Protein of unknown function (DUF 3339) (.1) AT5G40970 57 / 8e-13 Protein of unknown function (DUF 3339) (.1) AT3G01950 56 / 2e-12 Protein of unknown function (DUF 3339) (.1) AT5G14110 55 / 6e-12 Protein of unknown function (DUF 3339) (.1) AT5G40960 47 / 1e-08 Protein of unknown function (DUF 3339) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032028 [exp] 106 / 3e-32 AT3G48660 99 / 5e-29 Protein of unknown function (DUF 3339) (.1) Lus10041549 [exp] 94 / 4e-27 AT3G48660 91 / 4e-26 Protein of unknown function (DUF 3339) (.1) Lus10035201 [exp] 77 / 1e-20 AT5G08391 104 / 2e-31 Protein of unknown function (DUF 3339) (.1) Lus10032032 [exp] 77 / 1e-20 AT5G08391 104 / 2e-31 Protein of unknown function (DUF 3339) (.1) Lus10011353 [exp] 76 / 4e-20 AT3G48660 122 / 1e-38 Protein of unknown function (DUF 3339) (.1) Lus10015769 [exp] 75 / 8e-20 AT3G48660 112 / 1e-34 Protein of unknown function (DUF 3339) (.1) Lus10003120 [exp] 75 / 1e-19 AT3G48660 121 / 5e-38 Protein of unknown function (DUF 3339) (.1) Lus10037036 [exp] 74 / 3e-19 AT3G48660 112 / 3e-34 Protein of unknown function (DUF 3339) (.1) Lus10037035 [exp] 69 / 4e-17 AT5G08391 111 / 2e-34 Protein of unknown function (DUF 3339) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G170400 [exp] 78 / 7e-21 AT3G48660 89 / 3e-25 Protein of unknown function (DUF 3339) (.1) Potri.001G329000 [exp] 76 / 3e-20 AT5G08391 113 / 5e-35 Protein of unknown function (DUF 3339) (.1) Potri.017G064301 [exp] 74 / 3e-19 AT5G08391 108 / 5e-33 Protein of unknown function (DUF 3339) (.1) Potri.001G057900 [exp] 71 / 4e-18 AT5G08391 113 / 6e-35 Protein of unknown function (DUF 3339) (.1) Potri.003G170500 [exp] 71 / 4e-18 AT5G08391 112 / 9e-35 Protein of unknown function (DUF 3339) (.1) Potri.017G064500 [exp] 66 / 2e-16 AT3G27030 111 / 2e-33 unknown protein Potri.015G098300 [exp] 66 / 3e-16 AT3G48660 107 / 3e-32 Protein of unknown function (DUF 3339) (.1) Potri.001G328800 [exp] 64 / 1e-15 AT3G27030 79 / 2e-20 unknown protein Potri.001G328701 [exp] 66 / 2e-15 AT3G27027 115 / 7e-35 Protein of unknown function (DUF 3339) (.1) Potri.017G065444 [exp] 62 / 8e-15 AT3G48660 67 / 2e-16 Protein of unknown function (DUF 3339) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF11820 [flax] [poplar] DUF3339 Protein of unknown function (DUF3339)
Representative CDS sequence Show only first row Show all	>Lus10035198 pacid=23162564 polypeptide=Lus10035198 locus=Lus10035198.g ID=Lus10035198.BGIv1.0 annot-version=v1.0 ATGGCGGATTGGGGGCCAGTGGTAATAGCAGTGGTGCTGTTCATAATCCTGACGCCGGGTTTGCTCTGCCAGATTCCAGGGAATGGTCAAGTGATTGGTC TCTGCAACTTCCAGACCAGTCCCATTTCGATATTGGTCCATACAATCATCTTCTTTGGCCTCATCACCATTTTCCTCATAGCTGTTGGTGTTCACATCTC CACTGGCTGA
AA sequence Show only first row Show all	>Lus10035198 pacid=23162564 polypeptide=Lus10035198 locus=Lus10035198.g ID=Lus10035198.BGIv1.0 annot-version=v1.0 MADWGPVVIAVVLFIILTPGLLCQIPGNGQVIGLCNFQTSPISILVHTIIFFGLITIFLIAVGVHISTG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G48660			Protein of unknown function (D...		Lus10035198 [exp]	0	1
AT2G43990			unknown protein		Lus10008165 [exp]	3.9	0.8398
AT3G57540			Remorin family protein (.1)		Lus10042367 [exp]	4.0	0.8267
AT3G46620			zinc finger (C3HC4-type RING f...		Lus10012376 [exp]	6.9	0.7687
AT5G12300			Calcium-dependent lipid-bindin...		Lus10001346 [exp]	7.7	0.8265
AT5G13170		SAG29, SWEET15,...	senescence-associated gene 29 ...		Lus10011335 [exp]	8.4	0.8027
AT4G23700		ATCHX17	cation/H+ exchanger 17, cation...		Lus10024716 [exp]	12.4	0.7939
					Lus10032385 [exp]	14.5	0.7710
AT3G57540			Remorin family protein (.1)		Lus10026302 [exp]	15.1	0.8011
AT4G23700		ATCHX17	cation/H+ exchanger 17, cation...		Lus10024717 [exp]	16.0	0.7924
AT5G12380		ANNAT8	annexin 8 (.1)		Lus10010666 [exp]	17.0	0.7227

Compare expression of checked genes

Lus10035198 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.